KEGG   Coprinopsis cinerea: CC1G_05170Help
Entry
CC1G_05170        CDS       T01275                                 

Definition
hypothetical protein
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
cci  Coprinopsis cinerea
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cci00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CC1G_05170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1222 aa AA seqDB search
MASTTNQPSKITRQGSLLGTIKNIVAAPLTWLAGSEHDDSSDSTGKRRRLEPVSESGTTD
DGDNATRTKRMRLNSPPKTVAPTAYNDPPSSAFVPLRVKRRTPAPPLARSSSTSANILEP
PRNSRRNVSRSTLSPPRIGRTMSMDPPLSQLYISRDASIPDVVMESGQASNTRELSVPAG
SLTARPSFRMRTSLTPQPQPRELSEPPPISTLSLNPTFVRPPRPIQEEPKPSTTLGTLVE
SVRSARSPGRQHSSLLFGNTVQPDANHQPAPAPQAPAEKALYELDVYKTPLIPTRLRSAN
NPIASSSSDIPSMFKSRRTSQLVLMHDDRRSEKSGKKKRVKSPHRNDAKPYAGSGGMKKL
LAKRKKEEDDADVREREAGTKDEDMEKESKPEVAPQPAQTSNAPTDWFAAATAGTSLPSS
SLRVGRTKTSRNHIPRPAARSRLKFSAVYEEEDDSMDPEEEARRKERAALEEAANKMPVF
NIPAGFTFAKPDTKPLEQDLTNAKEPPISSLPFSFAKPAPVPEPSKAESSQSRKENAEGS
TLSSERPAEPSTVPSFAPRSLADAPPLGSSEPTKEPPTTPAGVPNFFAKSALLSKPLEVP
STPPLTFGTPSSSSTSVFNVAQSSSQAPGPVKDKENPFWEGDSKKESAAPEIQVTPPTTS
GFSFGAPATTQPAAATAFSFAKPEATATTGGFSFGKQTETAAAAPTTAETPSAPAVEPSK
PLFGTQPPAPTTQQSQPPSSEAKPESSSVPNFFGSTASKPFDGFKSQEPAAPPASTSFSF
GSSAASSTTASSTSAEPAKPLFGTSAADPPKPLFGATSTEPPKPLFGATAPAEPPKSLFG
GAPAEAPKPLFGSGALEAPKPTLPSSSSSPFSFGAPAKDTAPKASPFTFGAAPSTPPTHP
TTNGFSFKTDAPAASPSPVPFTFGSSAPSPAPAADKPFTFGAPAAAPPIQRPTTPKNNEQ
EFRMEESPTREMQANGASKPTLSFSFGQSANGSSTLFGGSTSGAPSPAPTSATPFSFGAT
TASNPFASSAKPEEPKPFSFGTPASTPTTTASPFSFGPSKSTGGEPARPNTTGSFSFGAT
STPTSTAAPFSFGTGAAAAPNPFAPSQPTSAPSSPSTFNQPSPFSFAAPLPATSSSTPFT
FGSQPASPAGSNSGLPATGGFGTATNGAFGATAAPSSPFNPPAQLAPSTSSGGTLFTIGA
APAPAAGRQIKKLPTRRAGAKR
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaccaccaaccagccatcgaagattacccggcaaggctcgttgctggggacc
atcaagaatatcgtagccgcccctttaacttggctggccggctcagaacacgacgacagc
tcggactccacaggcaagcgcaggcggcttgaacccgtctcagagtccggcactacagac
gatggcgataatgcgacacgtacgaagcgcatgaggctcaacagtccgcccaagacggtc
gcaccaacggcatataatgatcccccttcgtctgctttcgtcccccttcgtgtgaagcgc
agaacccctgcaccaccactcgctcgttcttcctcgacttcagcaaatatcttagagcca
ccccgtaattccaggcgcaatgtttcgcgatcgacactgtcgcctcctcgcattggtcgc
accatgtcgatggacccgcctttgagccagctttatatctccagagatgcctctatccct
gacgtggtcatggaatccggccaagcatccaacactcgtgagctctctgtccccgcagga
tcgcttactgcacgtccgtccttccgcatgcgaacctccctcaccccccaaccgcaaccc
cgtgagctgtctgagcccccgccaataagcactctctctttgaatcctacctttgtccgc
ccgcctcgcccgattcaggaggaaccgaaaccatcgacgacgcttggaacattggtcgaa
tcagtgagatctgcgcgatctcctggcaggcaacatagctcactcctctttgggaacact
gttcagccagacgctaatcatcagccagctccggctcctcaagctccggcagagaaggca
ctgtatgaattagatgtctacaaaacgcctcttattcctactcgtctccgctcagccaac
aacccgatcgcctccagctcctcggatatcccatcgatgttcaagtctcgacgcacttct
cagctcgttctcatgcatgacgatcgtcgatctgaaaaatctggcaagaagaagcgggtc
aagtcccctcatcgtaatgatgctaaaccttacgctggctctggtgggatgaagaaatta
ctggctaagaggaagaaagaggaagacgacgcagacgtccgagaaagggaagctgggacc
aaggatgaggatatggagaaggagtcgaagccggaagtcgcaccgcagccggcgcagacc
tccaacgcaccgaccgattggttcgctgcagccactgccggcacctctttgccatcgtca
tctcttcgtgttggtcgtactaagacttcgcggaaccacattcctcgcccagctgcccgg
agccgcctcaagttctccgctgtttacgaagaggaggatgattctatggatccggaagag
gaagccaggagaaaggagcgtgctgccctcgaagaagcagccaataagatgcccgtcttc
aacatccctgccgggttcacttttgcgaagcctgatactaagcctcttgagcaagacttg
accaatgccaaggaacctccgattagttctctgcctttctcctttgccaagcctgcccca
gtccccgaaccctccaaagcagagagttcacaatctcgcaaggagaatgccgagggttcg
acactctcctcagaacgaccggcggaaccgtcaacggtgccttcatttgcacctcgttcc
ttggctgatgccccacctctgggatccagtgaaccgaccaaagaaccaccgacaacaccc
gccggagtgcccaatttctttgcaaaatctgccctcttgtctaagccactcgaggttccc
tcgacgcctcctctcacctttggtacaccctcttcaagttccacgtctgtctttaatgtt
gcacaatcttcaagtcaggctccaggtccggtgaaagacaaagaaaaccccttctgggaa
ggcgacagcaagaaggagagcgcagctcctgaaatccaggtcacaccgccgactacctca
ggtttctcgttcggggcacctgctaccactcaaccagcagcggcgacagcgttctccttt
gcgaaacctgaagctaccgctactaccggaggattttccttcggcaagcaaacggagacc
gcggcagccgcgccaaccacggccgagaccccgtctgccccggcagtagagccatccaaa
ccgcttttcggcacgcagcctccggcaccaacgacacagcaatcacagccgccatccagt
gaggcgaagccagaatcttcttcagtacccaacttctttggttctactgcctccaagccg
ttcgacggtttcaagtcacaggagccggctgcgccaccggcatcgacgtcgttctctttt
ggctcctctgcagcatcgtctacaacagcctcgtccacttccgctgagccggccaagccg
ttatttgggacttctgcggctgaccctcctaagcctctgtttggcgcgacctccaccgaa
ccgcctaagccactgttcggtgccaccgcgcccgctgaaccgcccaagtccttgtttggg
ggtgcacccgccgaagctcccaaacctttgttcggaagcggcgctctcgaggcacccaaa
ccgaccctcccatcatcgagctcgagtccgttctcatttggtgcgcctgcgaaggataca
gcgccaaaggcttctcccttcacctttggggctgctcccagcaccccgcccacccatccg
actaccaatgggttctcattcaaaaccgatgcaccagcagcgtcgccttcgccggttccg
tttacgtttggttcttcagctcccagcccagccccagctgcggacaagccattcacattc
ggcgcacctgcggctgcaccgcccatccagcgtcctacaacgccaaagaataacgaacaa
gagttcaggatggaagagagtcccacgcgtgaaatgcaagctaacggagcttccaagcca
acattgagcttctcatttggtcagtcagccaacggatcatctactctgtttggtggctcc
acgtctggagcaccttctcccgccccaacgtcggctacaccattctcttttggcgctaca
accgcctcgaatcccttcgcatcctctgcgaaaccagaggagcccaaaccattctcgttt
ggaacacctgccagtaccccaacgaccaccgcttctcccttcagttttgggccgtccaaa
tctacgggtggtgagcccgcgcgacccaacacgacagggtctttcagttttggagcaacg
agcactcccacttcgacagctgcgcccttctcctttggaaccggtgctgcagccgctccg
aatccttttgcaccatctcaaccgacctccgccccgagcagtccttcgaccttcaaccaa
ccctctccattctcctttgcggcacctctccctgcgacatcctcttctacaccattcacc
tttggctcgcagcctgcttcccctgccgggtctaacagtggattgcctgcaactggtggg
ttcgggacagccacgaacggagcctttggggctaccgcggcaccctcgtctcctttcaac
cctcccgctcaattggcaccctcgacatcgtccggtggcacactgttcaccattggagct
gcacctgctcctgccgctggtcgtcagatcaaaaagctgcctacccgaagggctggagcc
aagcgttaa

DBGET integrated database retrieval system