KEGG   Coprinopsis cinerea: CC1G_05183Help
Entry
CC1G_05183        CDS       T01275                                 

Definition
(RefSeq) AGC/PKA protein kinase
Organism
cci  Coprinopsis cinerea
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 457 aa AA seqDB search
MSFQHHPTSLSMPAEPVRRISITYQQPSCPESQVVVTEAPITPPLSPKSIATKSGAMPVE
EMPICSSKPIQIHSEQEAMDVESAPVHQHPNTMPGEQQAQSQDQSNESQNRPQRCLEDQR
VRLQGSGLKLSDFEVRGTLGTGTFGKVLLVRHKTARDRHGAQSHFAMKVLRKTVIVQLRQ
VEHVNAERYILSRVNHPFIVDLFATFQDSLNVYMLMSYVPGGELFTHLRRAQRFTPDVTR
FYLATIILALKYLHSFNIIYRDLKPENLLLDSRGYLRLTDFGFAKIVDDRTWTLCGTPEY
LAPEIIQSDGHGKAADWWACGVLCYEMLVGYPPFFDESPYGIYEKILNGQIHWPRHIDRL
SKDLIKSFLNPDRTKRLGNMLGGPQDILDHPWFRGVDWDALERREINAPIIPRTTSVDDT
RHFLHLPPPTAEEIPGLVGQDLPQPRFDPINYHFLEF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtccttccagcatcacccaacatcgttatcaatgcccgctgaacccgttcggcggata
tcgattacataccagcagccttcgtgtccagaatcgcaggtcgtagtcactgaggccccc
ataactcctcccctttctcccaagtccatcgccacaaagtcgggcgctatgcccgtggaa
gaaatgcccatctgcagttcgaaacctattcaaatacactccgaacaggaggcgatggac
gtcgagtcggcgcccgttcaccaacatccgaataccatgccaggcgaacaacaagcccag
tcccaagatcagtctaacgaatcgcagaaccgcccacaacggtgtcttgaagaccagcgt
gttcggttgcagggttctggtttgaagctgtccgattttgaggtcaggggaacacttggc
accgggacgtttgggaaggtactcttggtgcgccataagaccgctcgagaccgacatgga
gcgcaaagtcattttgcgatgaaagtgcttcgcaaaacggtgatcgtgcaactgcgacaa
gtcgagcacgtcaatgcggaacgatatatcctctcgagggtgaaccatccattcatcgtg
gacctctttgcgaccttccaggacagtctcaacgtctatatgctcatgtcctatgtccct
gggggtgaacttttcacccatctgcgacgcgcacagcggttcactcctgacgttacccga
ttctaccttgccacgattatcctcgccctcaagtacctccactcgttcaacatcatctac
cgcgacttgaagcccgaaaaccttctgttggattctcggggttatctccgactcacagac
tttggcttcgcgaaaattgtcgacgaccgaacttggactctgtgtggcaccccagaatac
cttgccccagagattatccaatccgacggtcacggcaaggccgcggattggtgggcatgt
ggggtgttgtgctacgagatgctggttggatatccgcccttcttcgacgaatctccgtac
ggcatttacgaaaagattctgaacggccaaatccactggccgcggcacattgatcgtctt
tcaaaagacttgatcaagtcgttcctcaacccagatcgcaccaagcgactgggtaacatg
ctgggaggcccccaggatatccttgaccatccctggtttagaggtgttgattgggatgca
ttggaaaggcgtgaaatcaacgctcccattatcccaaggacgacatcggtcgacgatacc
cgccacttcttgcatctccctcctcctaccgctgaggaaatccccggccttgttgggcaa
gatctccctcagccacgctttgacccgatcaattaccacttcctcgagttttaa

DBGET integrated database retrieval system