KEGG   Coprinopsis cinerea: CC1G_05183Help
Entry
CC1G_05183        CDS       T01275                                 

Definition
AGC/PKA protein kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cci  Coprinopsis cinerea
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:cci00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CC1G_05183
Enzymes [BR:cci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CC1G_05183
Protein kinases [BR:cci01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CC1G_05183
Messenger RNA biogenesis [BR:cci03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CC1G_05183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 457 aa AA seqDB search
MSFQHHPTSLSMPAEPVRRISITYQQPSCPESQVVVTEAPITPPLSPKSIATKSGAMPVE
EMPICSSKPIQIHSEQEAMDVESAPVHQHPNTMPGEQQAQSQDQSNESQNRPQRCLEDQR
VRLQGSGLKLSDFEVRGTLGTGTFGKVLLVRHKTARDRHGAQSHFAMKVLRKTVIVQLRQ
VEHVNAERYILSRVNHPFIVDLFATFQDSLNVYMLMSYVPGGELFTHLRRAQRFTPDVTR
FYLATIILALKYLHSFNIIYRDLKPENLLLDSRGYLRLTDFGFAKIVDDRTWTLCGTPEY
LAPEIIQSDGHGKAADWWACGVLCYEMLVGYPPFFDESPYGIYEKILNGQIHWPRHIDRL
SKDLIKSFLNPDRTKRLGNMLGGPQDILDHPWFRGVDWDALERREINAPIIPRTTSVDDT
RHFLHLPPPTAEEIPGLVGQDLPQPRFDPINYHFLEF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtccttccagcatcacccaacatcgttatcaatgcccgctgaacccgttcggcggata
tcgattacataccagcagccttcgtgtccagaatcgcaggtcgtagtcactgaggccccc
ataactcctcccctttctcccaagtccatcgccacaaagtcgggcgctatgcccgtggaa
gaaatgcccatctgcagttcgaaacctattcaaatacactccgaacaggaggcgatggac
gtcgagtcggcgcccgttcaccaacatccgaataccatgccaggcgaacaacaagcccag
tcccaagatcagtctaacgaatcgcagaaccgcccacaacggtgtcttgaagaccagcgt
gttcggttgcagggttctggtttgaagctgtccgattttgaggtcaggggaacacttggc
accgggacgtttgggaaggtactcttggtgcgccataagaccgctcgagaccgacatgga
gcgcaaagtcattttgcgatgaaagtgcttcgcaaaacggtgatcgtgcaactgcgacaa
gtcgagcacgtcaatgcggaacgatatatcctctcgagggtgaaccatccattcatcgtg
gacctctttgcgaccttccaggacagtctcaacgtctatatgctcatgtcctatgtccct
gggggtgaacttttcacccatctgcgacgcgcacagcggttcactcctgacgttacccga
ttctaccttgccacgattatcctcgccctcaagtacctccactcgttcaacatcatctac
cgcgacttgaagcccgaaaaccttctgttggattctcggggttatctccgactcacagac
tttggcttcgcgaaaattgtcgacgaccgaacttggactctgtgtggcaccccagaatac
cttgccccagagattatccaatccgacggtcacggcaaggccgcggattggtgggcatgt
ggggtgttgtgctacgagatgctggttggatatccgcccttcttcgacgaatctccgtac
ggcatttacgaaaagattctgaacggccaaatccactggccgcggcacattgatcgtctt
tcaaaagacttgatcaagtcgttcctcaacccagatcgcaccaagcgactgggtaacatg
ctgggaggcccccaggatatccttgaccatccctggtttagaggtgttgattgggatgca
ttggaaaggcgtgaaatcaacgctcccattatcccaaggacgacatcggtcgacgatacc
cgccacttcttgcatctccctcctcctaccgctgaggaaatccccggccttgttgggcaa
gatctccctcagccacgctttgacccgatcaattaccacttcctcgagttttaa

DBGET integrated database retrieval system