KEGG   Coprinopsis cinerea: CC1G_05453Help
Entry
CC1G_05453        CDS       T01275                                 

Definition
eukaryotic translation initiation factor 4E-1A
Orthology
K03259  
translation initiation factor 4E
Organism
cci  Coprinopsis cinerea
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cci00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CC1G_05453
Translation factors [BR:cci03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CC1G_05453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 426 aa AA seqDB search
MSSKGSTTETPSKPAGAGRLPSLNQLAARINPTPVANGTPSAPRPRLAASVLRTGSTVSL
ASTAASTTDSMAVNAPTTRSASPAGSGVSGSPQSSNTPVPEGGEALTSEKLDKLNQENAD
GAPAPLSKKFVKGYKNVPSLDAITARMVRTRQLSIDGTARPPEPELIEDPKTPGVQMKAP
EHPLQFPWTIFHDTKAKYPYTPALASGEAPPLSAAPPVPESSSEYEAGLTVIGEFDTVES
FWRYFNWLKPPSALEKNSNYHLFKSGIKPMWEDEANANGGKWVLTMKNNPQLLDRCWYSI
AMALIGEELEEGDEICGAVVSLRTKVDRIQLWTRSKEDVERLNAIGKKMVKLLDVSEADG
IGLEFQYNSDDRPPPNKFLSISALPQTSYRSSFQPQPGTPVGGPGGAFGSFGMGIGGGWK
GGAKRG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgaagggttccacgaccgaaacgccctcgaagccagctggcgctggccgtctg
ccgtctctcaaccaactcgctgctcgtatcaacccaacgccagtcgccaatggcacccca
tcggcaccgcggccccgcctcgcagcgtcggtgctgagaactggatccaccgtctcgctg
gcatcgaccgcagcgtcgacaaccgattctatggccgtcaacgccccgaccacacgatcc
gcctcgccagcgggcagcggggtctctggatccccgcagtcgtcgaatacacccgtcccc
gaaggcggcgaggctctgacatcggagaagctcgataaactcaaccaggagaacgcggac
ggtgcgcctgcgccgctctcgaagaagttcgtcaagggatataagaacgtgcccagtttg
gacgctatcacggctaggatggtcaggactcgccagttgagtatagatggaacagccagg
ccgcccgagcctgagttgattgaggatcccaagacccccggtgtccagatgaaggcccca
gagcatcctctgcagttcccctggacgatcttccacgacacaaaggccaagtacccctac
acccccgcactcgcgtctggagaagctccgcccttgtcggcagccccacccgtcccagag
tcgagctcagaatacgaagcaggcctcaccgtcatcggcgagttcgacaccgtcgagtcc
ttctggcggtacttcaactggctcaagccaccctccgccctcgagaaaaacagcaactac
catctcttcaagtcgggcatcaagcccatgtgggaagacgaggctaatgcgaatggtgga
aagtgggttttgacgatgaagaacaaccctcagttgctcgatcgttgctggtactccata
gctatggccctgatcggtgaagaactcgaggagggagacgagatctgcggtgcagtcgtc
agtcttcgcaccaaggtcgaccgtatccagctctggactcgaagcaaggaagacgtggag
aggctcaacgctattggcaagaagatggtcaaattactggatgtctctgaagctgatggt
attggtcttgaattccaatacaacagcgacgaccgtcctcccccgaacaagttcttgtcc
atctcggcactgcctcagacatcgtacagatcttccttccaacctcagcctggtacacca
gtcggcggtcccggtggcgcgtttggaagcttcggcatgggtatcggtggtgggtggaag
ggtggagccaagcgaggttga

DBGET integrated database retrieval system