KEGG   Coprinopsis cinerea: CC1G_05599Help
Entry
CC1G_05599        CDS       T01275                                 

Definition
monooxygenase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
cci  Coprinopsis cinerea
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cci00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:cci00740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 354 aa AA seqDB search
MAPLRFSFLVLAVALQSIFLSQVFAAPAPVEEAQPFQRRAKCANIRIRKEWRDLTVAERQ
DYIRAVKCLMSTPSTSTRRGVVSRFDEFQACHIDLTDEVHQVGHFLAWHRHFLTLYANAM
RDECGYQGPATYWDWSRDADGPGRMRDSPVFDPVTGFGGDGATSSPSPNPGNPGFPGFPG
FPGGGGGCVATGPFNTTRLNLGPGTAVGEHCLTRAIGDQMKSSLTSANVQATLAQTTFET
FRTTLENGGRAVNGFGIHGGGHAAVGGEMVNPYSSPGDPLFYLHHGNLDRIWWKWQSADL
ANRLNAISGPTTQRPPFTNVTLNFMMPYTSLIPPLAVREIMDIEAEPSCFQYAD
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggctcctctcagattctcgttcctcgttcttgctgttgctctacaaagcatcttcctg
tcgcaggtcttcgctgcgcccgctcccgtggaagaggcccagcccttccaaaggcgtgcc
aaatgcgcgaacattcgcattcgcaaagaatggcgtgacttgaccgtcgctgaacgacaa
gactacatccgtgccgtgaaatgtctgatgtccactccatcgactagcactcgccgcggt
gtagtgtcgcgtttcgacgagttccaggcttgccacatcgatctcaccgacgaggttcac
caagtcggtcacttcctcgcatggcaccgtcacttcctcaccctctacgccaacgccatg
cgggatgaatgtggttaccaaggccccgcgacatactgggactggtcgagagacgcagat
ggcccgggaagaatgcgtgactcgccagtttttgaccccgttactggtttcggaggagac
ggcgccacttcttctcccagccctaatccaggaaacccaggtttccccggcttcccgggt
ttccctggtggtggtggaggctgcgtcgccaccggccccttcaacaccacgcgactcaac
cttggccctggcaccgctgtcggtgaacactgcttgacaagagccatcggcgaccagatg
aagtccagtcttacctctgctaatgtccaggcaaccctcgcccagaccaccttcgagacg
ttccgcacgacgctggaaaatggtgggcgagccgtgaacggtttcggtattcatggtgga
ggccacgctgcagtcggtggcgagatggtgaacccttactccagccctggtgaccctctt
ttctacctccaccacggaaacctcgatcgtatctggtggaagtggcaatccgcagacctc
gccaaccgcctcaacgccatctccggacccaccactcaacgacctcccttcacgaacgtc
acgctcaactttatgatgccttacaccagtctgatcccacccctcgccgtccgcgagatt
atggatattgaagctgagcccagttgcttccagtacgccgactga

DBGET integrated database retrieval system