KEGG   Coprinopsis cinerea: CC1G_05599Help
Entry
CC1G_05599        CDS       T01275                                 

Definition
monooxygenase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
cci  Coprinopsis cinerea
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CC1G_05599
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CC1G_05599
Enzymes [BR:cci01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     CC1G_05599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 354 aa AA seqDB search
MAPLRFSFLVLAVALQSIFLSQVFAAPAPVEEAQPFQRRAKCANIRIRKEWRDLTVAERQ
DYIRAVKCLMSTPSTSTRRGVVSRFDEFQACHIDLTDEVHQVGHFLAWHRHFLTLYANAM
RDECGYQGPATYWDWSRDADGPGRMRDSPVFDPVTGFGGDGATSSPSPNPGNPGFPGFPG
FPGGGGGCVATGPFNTTRLNLGPGTAVGEHCLTRAIGDQMKSSLTSANVQATLAQTTFET
FRTTLENGGRAVNGFGIHGGGHAAVGGEMVNPYSSPGDPLFYLHHGNLDRIWWKWQSADL
ANRLNAISGPTTQRPPFTNVTLNFMMPYTSLIPPLAVREIMDIEAEPSCFQYAD
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggctcctctcagattctcgttcctcgttcttgctgttgctctacaaagcatcttcctg
tcgcaggtcttcgctgcgcccgctcccgtggaagaggcccagcccttccaaaggcgtgcc
aaatgcgcgaacattcgcattcgcaaagaatggcgtgacttgaccgtcgctgaacgacaa
gactacatccgtgccgtgaaatgtctgatgtccactccatcgactagcactcgccgcggt
gtagtgtcgcgtttcgacgagttccaggcttgccacatcgatctcaccgacgaggttcac
caagtcggtcacttcctcgcatggcaccgtcacttcctcaccctctacgccaacgccatg
cgggatgaatgtggttaccaaggccccgcgacatactgggactggtcgagagacgcagat
ggcccgggaagaatgcgtgactcgccagtttttgaccccgttactggtttcggaggagac
ggcgccacttcttctcccagccctaatccaggaaacccaggtttccccggcttcccgggt
ttccctggtggtggtggaggctgcgtcgccaccggccccttcaacaccacgcgactcaac
cttggccctggcaccgctgtcggtgaacactgcttgacaagagccatcggcgaccagatg
aagtccagtcttacctctgctaatgtccaggcaaccctcgcccagaccaccttcgagacg
ttccgcacgacgctggaaaatggtgggcgagccgtgaacggtttcggtattcatggtgga
ggccacgctgcagtcggtggcgagatggtgaacccttactccagccctggtgaccctctt
ttctacctccaccacggaaacctcgatcgtatctggtggaagtggcaatccgcagacctc
gccaaccgcctcaacgccatctccggacccaccactcaacgacctcccttcacgaacgtc
acgctcaactttatgatgccttacaccagtctgatcccacccctcgccgtccgcgagatt
atggatattgaagctgagcccagttgcttccagtacgccgactga

DBGET integrated database retrieval system