KEGG   Coprinopsis cinerea: CC1G_05661Help
Entry
CC1G_05661        CDS       T01275                                 

Definition
clathrin heavy chain 1
Orthology
K04646  
clathrin heavy chain
Organism
cci  Coprinopsis cinerea
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cci00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CC1G_05661
Exosome [BR:cci04147]
 Exosomal proteins
  Proteins found in most exosomes
   CC1G_05661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1700 aa AA seqDB search
MAAADISKPIAFCEHLQLSSLGVQPASISFQTLTLESDHFICVREKINEQNQVVIIDLTD
ANNVLRRPITADSAIMHPTKKILALKGTYIIPPSTNSSLTDIRLLSAQRTLQIFNIETKQ
KVKNHVNNEDIVFWKWVSETTIGMVTETAVYHWSIADQTSPPQKVFDRHPTLAGTQIINY
RVTPDEKWLVLIGISGNTTNPSAFKVKGSMQLYSRERGVSQPIEGHAAAFAEIKLDGHQK
PTKLFTFAVRTATGAKLHIVEIDHQAPDPPFTKKNVDVYFPPEATNDFPVAMQISKKHGI
IYMVSKYGFIHLYDLESGACIYMNRISGETIFVTAEHEATNGIIGVNKKGQVLSVNVDDQ
TIIPYILSTLNNTELAFKLASRANLPGADDLYVKQYQQLFAAGQYGEAAKVAANSPRGIL
RTNAVIESFKQAPAPPGGLSPILQYFGILLEKGELNHLESLELARPVLQQGRKQLLEKWL
KENKLTCSEELGDIVRLHDMTLALSVYLRANVPNKVIACFAETGQTDKIVLYSKKVGYTP
DYTALLQHIMRTSPEKGAEFASQLVNDETGPLVDVERVVDIFMSQNMIQPATSFLLDALK
DNKPEQGHLQTRLLEMNLVHAPQVADAILGNEMFTHYDRPRIANLCEKAGLLQRALEHYE
DIADIKRAIVHTAGLQPDWLVNYFSRLTTEQSFACLQEMLKVNIRQNLQVVIQIATKYSD
ILGPIKLIEMFESFKSFEGLYYYLGSIVNLSEDPEVHFKYIQAATRTGQIREVERICRES
NFYNPEKVKNFLKEAKLQDQLPLIIVCDRFDFVHDLVLYLYQNGLTKFIEVYVQRVNSVR
TPQVIGGLLDVDCDETTIKSLLASVTGNFPIDELVQEVEQRNRLKLILPWLEARVQSGSQ
DPAVFNAMAKIYIDSNNNPEQFLKENNLYEPLVVGKFCEKRDPYLAYIAYAKGFCDDELI
AITNENSMFKQQARYLVKRRQPELWAQVLVGENIHRRALIDQIVATALPECTDPDDVSVT
VKAFLQADLPIELIELLEKIVIEPSPFSDNKNLQNLLLLTAIRSDKGKVVGYINKLNNYD
AAEIAKIATEHGLYEEALTIYKKHDQHVMAINVLVEHIVSIDRGYDYANKINEPAVWSRL
AKAQLDGLRIKDSVDSYIKAQDPSNFEEVIEIANHAGKHDDLVRYLQMARKTLREPKIDT
ELAYAYAKTDRLHDMEDFLGMTNVADILVVGEKCFEDELYQAAKLLFTSISNWARLATTL
IYLGENQAAVESARKAGNTQVWKQVHAACVEKGEFRLAQICGLNIIVHAEELAALIAMYE
RRGHFEEIINLLEAGLSLERAHMGIFTELAILLSKYKPAKLMEHLKLFVARINIPKVIRA
TEKAHLWPELVFLYIKYDEFDNASLAMIERSADAWEHNQFKDVIVRAANVEIYYKALTFY
LQEQPTLLTDLLTVMIPRIDHSRVVRMFRQIDHIPLIRSYLIAVQHLNIEAVNDAYNDLL
IEEEDYKTLRDSIDSFDNFNNIALAKRLEKHELLEFRRLAAHLYKKNSRWEESIALSKQD
KLYKDAMVTAATSNSTEVAEELLSYFVDIGNKECFAAMLYICFDLLRSDVVMELSWQHGL
NDFYMPYKIQIERTRVEKMAQLEKEVKERSKKDAQKEQAEADAPIINPGGFGNRLLLENG
GFGAAAAPPLNGMPYAMTGF
NT seq 5103 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgcagacatctcaaaaccaatcgctttctgcgaacacctgcagctctcgagt
ttgggcgttcagccagcttcaatctctttccagactctgacccttgaatccgaccatttc
atctgtgttcgcgagaaaatcaatgagcagaaccaagtcgtcatcatcgaccttaccgat
gccaacaatgtcctgcgacggccaattactgcggattcagctattatgcacccaaccaag
aagattctcgccctgaaaggcacgtatatcataccgccatcaactaactcgtccctgact
gatattcgcctcctctcagcccagcggacattgcagattttcaatatcgagacgaagcag
aaggtcaagaaccacgttaataacgaagatatcgtgttctggaaatgggtttctgagacg
actatcggtatggtcaccgagaccgccgtgtatcactggtcaatcgcagaccagacatcg
cccccgcagaaggtcttcgaccgtcacccgaccctcgctggcacccagattatcaactac
cgcgtcacgcccgatgagaaatggctggtgctcattggtatctctggaaacaccaccaat
ccctctgcattcaaggtcaagggatccatgcagctgtacagcagggaacgtggagttagc
cagcctatcgaaggtcacgctgctgcgtttgcagaaatcaagttggatggtcaccagaaa
cccaccaagctgttcacgttcgctgtgcgaactgcaactggtgccaagctccatatcgtc
gaaattgaccaccaagctcccgacccacctttcaccaagaagaacgtcgatgtctacttc
cctcccgaggcaacgaacgacttccccgtggccatgcagatctccaagaagcatggaatc
atctacatggtctccaagtacggcttcatccacctttacgacttggagagcggcgcgtgc
atctacatgaaccgtatttccggcgagaccatcttcgtcaccgccgagcatgaagctacc
aacggtatcattggtgtcaacaagaagggtcaagtcctcagtgtcaacgtcgatgatcag
accatcattccttacatcctctccaccctcaacaacacggagctcgcgttcaaacttgcc
agtcgggccaaccttcctggtgcggacgatttgtacgtgaagcagtaccaacagttgttc
gctgctggccagtacggggaggctgcaaaggttgctgccaactcgccgagaggtattctg
cgtaccaatgctgtcatcgagtccttcaagcaagccccagctcctcctggtggcttgtcc
cctatcctccaatactttggtattctcttggagaagggtgaactcaaccatctcgaatca
ttggaacttgcccgccctgttcttcaacagggccgtaagcaacttctcgagaagtggttg
aaggagaacaagttgacttgcagcgaagagcttggtgatatcgttcgtcttcacgatatg
actctcgcgttgagcgtctacctgcgcgccaacgttcccaacaaggtcatcgcttgcttt
gcagagaccggtcagaccgacaagatcgttctctactccaagaaggtcggatatacccct
gactataccgccctcctccaacatatcatgcgtacatcacctgagaagggtgccgagttt
gcgtcccaactcgtcaacgatgagaccggtcctctggtcgacgttgagcgggttgtcgat
atcttcatgtcccagaacatgatccaaccggccacctcgttccttttggatgccctcaag
gataacaagcctgagcagggtcatctccagactcgtctcttggagatgaacttggttcat
gcccctcaggttgcggatgccattctcggaaacgagatgttcacccactacgaccgacct
cgtattgccaacctttgcgagaaggcaggccttttgcaacgggctctcgagcactacgag
gatatcgccgacatcaagcgtgccatcgtccataccgctggacttcaacccgattggctc
gtcaactacttcagcaggctcaccactgagcaatccttcgcttgcttgcaagaaatgttg
aaggtcaacatccgccagaacttgcaagtcgtcatccagattgccaccaagtactccgac
atcctcggacccatcaagctgattgagatgttcgagtcgttcaagagcttcgaaggtctc
tactactaccttggctccatcgtcaacctcagcgaggatcctgaagttcacttcaaatac
atccaagctgccacacgcaccggccagatccgtgaagtcgagcgcatttgcagggagagc
aacttttacaacccggagaaggtcaagaacttcctcaaggaggccaagcttcaggaccaa
ctccctctcatcatcgtctgcgaccgcttcgactttgttcatgacctcgtgttgtacctc
taccagaacggcctcaccaagttcatcgaggtctacgtccagcgtgtcaactctgtccgc
actcctcaagtcattggtggtcttttggacgttgactgcgatgagactaccatcaagagt
ctccttgcgtctgtgactggcaacttccccatcgatgagcttgtccaggaggtcgagcag
cgcaataggttgaagttgatcctgccttggcttgaagctcgtgttcagagcggaagccag
gatcctgccgttttcaatgccatggccaagatctacatcgacagcaacaacaaccctgag
cagttcttgaaggagaacaacctctacgagcctttggtcgtcggtaaattctgtgagaaa
cgtgatccttaccttgcatacatcgcctatgcaaagggcttctgcgacgatgagttgatc
gccatcaccaatgagaactcgatgttcaagcaacaagctcgctacttggtgaagcgcaga
caacctgaactctgggcgcaagtcctcgttggcgagaacattcaccgacgtgctctcatc
gaccagattgtcgctaccgcccttcccgagtgcactgaccccgacgatgtctcggtcacc
gtcaaggccttcttgcaagctgacctccccatcgagttgatcgagctcttggagaagatc
gtcatcgagccctcgcccttcagcgacaacaagaacctccagaacttgctcctcctgact
gccatccgttccgacaagggcaaggtcgtcggctacatcaacaagttgaacaactatgat
gctgctgagattgccaagattgcgactgagcacgggttgtacgaggaggcgttgaccatt
tacaagaagcatgaccaacatgttatggctatcaacgtcctcgttgagcatattgtgtcc
attgatcgtggatatgattatgccaacaagatcaacgagcctgccgtctggagtcgattg
gccaaggctcagttggatggtcttcgtatcaaggactctgttgattcgtacatcaaggct
caggacccctccaactttgaggaagtcatcgagatcgccaaccatgctggcaagcacgac
gacctcgtccgatacctccagatggcccgcaagaccctccgcgagcccaagatcgacacc
gagcttgcctatgcctatgccaagaccgaccgtctccacgacatggaagactttttgggc
atgaccaacgttgcggacatcctcgttgttggagagaagtgtttcgaggacgagttgtac
caggctgccaagttgttgttcactagcatttccaactgggcccgtttggctaccaccctc
atctaccttggtgaaaaccaggctgcggttgagagtgctcgcaaagctggaaatacccag
gtttggaagcaggttcatgctgcttgtgttgagaagggagagttccgcttggctcaaatt
tgcggtctcaacatcatcgtccatgctgaagagttggctgctctcattgccatgtatgag
cgccgaggccactttgaagagatcatcaacttgttggaggctggtttgagcttggagcgt
gctcatatgggtattttcactgagcttgctatcctgctcagcaagtacaagcctgctaag
ctcatggaacatctcaagttgttcgttgctcgtatcaacatccccaaggtcatccgtgcc
actgagaaggctcatctctggcccgagcttgtcttcctctacatcaaatacgatgaattc
gataacgcttcgttggctatgattgagcgctctgctgatgcctgggagcacaatcagttc
aaggatgtcatcgtccgtgctgcgaacgtcgagatctactacaaggcccttaccttctat
ctgcaagagcaacctaccttgctcaccgacctgctcactgtgatgatcccccgaatcgac
catagtcgagtggttcgcatgttcaggcagattgatcatatccctctcatccggtcgtat
ttgattgctgtccaacatcttaacatcgaggctgtcaacgatgcctacaacgatcttttg
attgaagaggaggattacaagaccttgcgagattcgattgatagctttgacaacttcaac
aacattgctcttgctaaacggctggagaagcacgagctcctcgagttccgacgattggct
gctcacctctacaagaaaaactcgcgctgggaagagtcgatagccttgtcaaagcaagac
aagctttacaaggatgccatggtcaccgctgccacttccaactcgacagaagttgccgag
gagctcctctcgtatttcgtcgacattggaaacaaggagtgcttcgccgcgatgctttac
atttgcttcgacctcttgcgctctgatgtggtcatggagctttcatggcagcatggtttg
aatgacttctacatgccatacaagatccagatcgagagaacgcgggttgagaagatggct
caactcgagaaggaagtcaaggagcgctcaaagaaggacgctcaaaaagaacaagccgaa
gctgacgcacctatcatcaaccctggtggctttggaaaccgactattgctcgagaacggt
gggtttggtgcggcagcggctccgccattaaacggcatgccttacgcgatgactgggttc
tga

DBGET integrated database retrieval system