KEGG   Coprinopsis cinerea: CC1G_05800Help
Entry
CC1G_05800        CDS       T01275                                 

Definition
ubiquitin carboxyl-terminal hydrolase 14
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
cci  Coprinopsis cinerea
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 785 aa AA seqDB search
MSCSHIDTISTLPPPRLSQAVHREECTQCFDNQDLPAGIDVCLVCFNGGCLDNERRHAQN
HVQKSGHKFTLNIKRKVKPSAQRAESEEPPAKMTKLAIVEEREEDKYDQFTVVKCWLCDR
EKGLEVPEASSNPGVKSLVDGVLQSLSSARQSEVKAWEEEIVPCEHTLTLEQLQTGPIPQ
SGLAHCNACDLKENLWLCLTCGSLGCGRQQYGGLGGNGHGLAHFESTGHAVSVKLGTITA
EGEADIYCYVCNDAKQDPELARHLSTFGINVQTLTKTEKSMTELQIEHNLKYDFSLVGED
GQALEPVFGPGLTGLANLGNSCYMASVLQTIFSLPAFQKRYNDLAVNHARACTVSLPADC
VECQMHKVADGLLSGRYSHPANYAASPHQTPTVSSSDPLQHASPTPVFQTGIRPAGFKTL
IGKGHEEFSTMKQQDSEEFFTHLLTVLRRDMHKFKDRSEQDATTIFSYALEQRLQCNDCK
KVRYRNDTMDSVSVAVPAKEKSKDAEGKIEYEDVLLTSCLDALLSPEALEYSCPSCQKNV
HALKQTKFASFPETLVVHAKKFQLVNWVPTKLGEEEFPAEAAEAAPGLPEFNAAAMAQLE
GMGFPTVRCQKALLATGNSDPEAAMEWLFAHMEDPDIDDPIPIPGPGGSSAGPEPSPEQV
AMLADMGFTPAQAKKALRETSGNAERAVEWLFNHPDDTGEEAAPAPSTSSAPPTLPGSTA
VPARYKLKAFISHKGPSVHSGHYVAHIRVSDDQWVLFNDEKVVKADAESVRDLKRLAYLY
VFEKI
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgctcacatatcgacacgatctcgacgttaccgccacccagactgtctcaggca
gtgcacagggaagaatgcacacaatgctttgacaatcaggatttaccagccggcatcgac
gtctgcctcgtctgcttcaatggcgggtgcctcgataacgagcgcagacacgcccagaac
catgtccagaagagcgggcacaagtttaccttgaacatcaagcgaaaggtgaagccatcg
gcgcagcgcgctgaaagcgaagaaccacccgcaaagatgaccaaactggcgatcgttgaa
gagcgggaagaagacaagtatgatcagtttaccgtcgtgaagtgctggctttgcgatcgt
gaaaaaggtctcgaagttccagaggcgtcgagcaatccaggagttaaatcactagtcgac
ggcgttctgcaatcgctatcgtcggcgcggcagtcagaagtcaaggcctgggaagaagaa
atagttccttgcgagcacaccttgacgttggaacagctccagacaggaccaattccacag
tcgggcctagctcactgtaacgcgtgcgacttgaaggagaatctttggctttgtttgacc
tgcggctcgctcggttgtgggcgacaacagtatggagggctgggaggaaacggacatggt
ctcgctcatttcgaatcgactggacatgctgtcagcgtcaagcttggaacgatcacggct
gaaggcgaggcagacatctactgctacgtttgtaacgacgctaaacaggaccctgaactc
gctcgccatttgtcgactttcggaattaacgtacaaaccctcaccaagaccgagaagagc
atgacagagctacagatcgaacacaatctcaagtacgatttctctctcgttggcgaagat
gggcaagccttggagccggtatttggtcctggcctcacaggtctggcaaacctgggcaac
agctgctacatggcgtcggtccttcaaaccatcttctcgctaccggccttccagaaacgg
tacaacgaccttgctgtgaaccacgccagagcctgcactgtgtccctgcctgccgactgc
gtcgagtgtcagatgcacaaggttgccgacggcttgctcagcggacgctactctcatccc
gccaactatgctgcttcaccacatcaaactccgaccgtgtcttcatctgatccactccaa
cacgcttcccctacacccgtcttccagactggcatcaggccagcaggcttcaaaactctg
attggcaagggtcacgaagagttctcaacgatgaagcagcaggactcggaagagttcttc
actcatttgctgacggtcttgagaagagacatgcataaattcaaggatcgttcagagcaa
gacgccactaccatcttctcctacgctttggaacaacgcctgcaatgcaacgactgcaag
aaggtccgataccgcaacgataccatggactctgtcagcgtcgctgtaccggccaaagag
aagagcaaagacgcggagggcaagattgagtacgaagatgtgctcctcacctcctgcctg
gatgccctattgagccccgaagcacttgaatattcttgcccctcatgtcagaagaacgtt
cacgctctcaagcagaccaagtttgcctcgttccccgaaacactcgtcgtgcatgccaag
aagttccaactcgtgaactgggtaccaaccaagctcggagaagaggagttcccggccgaa
gcagcggaagccgcgccaggactacccgaatttaacgctgcagcgatggctcagctcgaa
ggcatgggcttccccactgttcggtgccagaaggcgctacttgcgacaggaaacagcgat
cctgaagctgcgatggaatggttgttcgcccacatggaggatcctgacatcgatgaccct
attccaatcccgggacctggaggatcgagtgcagggcctgaaccctcgcctgaacaggta
gcgatgctggcggatatgggtttcacccctgcccaggcgaagaaggccttacgagagacg
tctggtaatgctgaacgggcggttgaatggttgttcaatcatcctgatgacaccggcgag
gaagctgctcctgctccttcgacgtcgtctgcacctcctactcttccaggatcgaccgct
gttcccgcacgttacaaactcaaggctttcatctcgcataaaggtccttcagtccattcg
ggacactatgtcgcacatattagggtgtcggatgatcaatgggtgcttttcaatgacgaa
aaggttgtgaaggcggatgcggagagtgtgagggatttgaagcggctggcgtatttgtat
gtctttgagaagatttga

DBGET integrated database retrieval system