KEGG   Coprinopsis cinerea: CC1G_06076Help
Entry
CC1G_06076        CDS       T01275                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cci  Coprinopsis cinerea
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cci01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cci00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 503 aa AA seqDB search
MSQDLGLMARSKHGPPCTIVIKLGTSSIVHETTHQPLLSTLASVVEVVVRLRSFGHKVVL
VSSGAIGVGLQRMSLPRRPKGLAKKQALAAIGQGRLIALWDNLFGQFEQPIAQVLLTRGD
ISDRTRYLNAVNTLKELLSMGVVPIVNENDTVSVSEIKFGDNDTLSAITSSMIHADYLFL
LTDVDGLYTSNPRKDPDAKQIEEVKSISEIRAQVSTSTLGSSLGTGGMETKLIAAEIASA
AGVTTIITSSKKPENVLGIVDYHNRYTLLRKFSSRPSSPTVAGSGRASPESQPGSGSASP
VPLPRPPHTVFIASSTPLRDLKSWTSHTLYPAGSVVIDAGAHHVLSKRQSGGRLLPAGVV
GVIGAFASGQAVRITVRKGKEGDKEVEEEKQRYVNSYDTSRPTTPASGLQSSAASSSDDH
DHPPAKGVHFEEDTEEQISEDDVIEVGRGLANFNSAQVSRVKGLKSSQLSVVLGYADSEY
VVENITIRIPPSQLATLGQTASP
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaggatttaggcctcatggcgcgcagcaaacacggtccaccgtgcacgatcgtc
atcaagctcggcacatcgtccattgtccatgagacgacccatcagcctttactctcgacg
ctggcgtcggtggtcgaggtcgtcgttcggttgaggagctttgggcacaaggtcgtgttg
gttagttctggtgccatcggtgttggcctgcaacggatgagcttgccgcggaggccaaaa
ggactagcgaagaagcaagctttggcggctattggacaggggaggctgatcgccctctgg
gacaatttgttcggacaattcgagcaacctattgcgcaagttctactcaccagaggcgac
atctccgaccgaacacgatacctcaatgccgtgaacaccctcaaggagctgctctcgatg
ggtgtcgttcccatcgtgaacgaaaacgataccgtgtctgttagcgaaatcaaatttggt
gacaacgacaccttatcagccatcacttcctccatgatccacgcagattatctcttcctt
cttacggacgtagacggactgtacaccagcaatccacgaaaggacccagatgcaaaacaa
attgaggaggttaaatcgatttctgaaattcgtgctcaagttagtacatcgacgttgggg
tccagcctcggtacaggcgggatggagaccaaactcatcgcagcagaaatagcatctgca
gctggcgtaaccaccatcattacctcaagtaaaaagccggagaacgtcctaggcatcgtc
gactaccacaaccgctacacccttctccgcaagttctcctccagaccgtctagtcccact
gtggcaggttctggccgcgctagcccagagtcgcagccgggcagcggctcggcctctccc
gttcctttacctcgcccaccacataccgtgttcatcgcttcctcgaccccattgcgcgac
ctcaagtcgtggacgagtcataccctataccctgccggcagtgtggtaatcgatgctgga
gcacaccatgtcctttcgaaacgacagtctggagggaggttgttgccagcaggtgtggtt
ggtgtgattggcgcgtttgcctctggccaggcggtgcgaataacggtgaggaagggtaaa
gagggggataaggaggttgaagaagagaagcagcgctacgttaattcctacgatacgagc
agaccaacgactcctgcttccggactgcaatcgagcgcggccagttcgagcgatgaccat
gaccatccaccggcaaagggtgtccatttcgaggaggatacggaggagcagattagcgaa
gacgatgtgatcgaagttgggcgaggactggccaacttcaactctgcgcaggtgtcccgc
gtgaagggactgaaaagttcacaactcagtgtggtactcgggtacgcagactcggagtat
gttgttgagaacattacgattagaattccccctagccagctggctaccctaggtcagact
gcgtctccgtga

DBGET integrated database retrieval system