KEGG   Coprinopsis cinerea: CC1G_06324Help
Entry
CC1G_06324        CDS       T01275                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cci  Coprinopsis cinerea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cci00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 380 aa AA seqDB search
MKSVLSPLSATVIALLSTAAVAVPPYGQCGGSGYTGPSDCDSGYTCVPVNQWYHQCQPGS
SAPTNPPNPPVATTTTTAPRPTNSACPGAVTKFRYFGVNQAGAEFGSNIIPGELGTHYIW
PAPSSIDFFVNEGFNTFRIPFQLERLNPPARGLTGSFEQPYLQDLKRTVDYITRNKNSFA
IIERWRNLATEFRDNDKVIFDVMNEPHTMDARVVFDLNQAAVNAIREAGATRQLILVEGT
SWTGAWTWTTTSGNGNVFQNIRDPNNNVAIQMHQYLDSDGSGTSPTCVSSSIGRERLAAA
TAWLKQHNLKGFLGELGAGSNPTCIEAIKGALCSLQESDVWIGWAWWAAGPWWGNYFQSI
EPPNGPALAQMYPQAIKPFI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctgtgctctccccgctgtctgcaactgtgattgctctgttgagcactgcggct
gttgccgttcccccctacggccagtgcggtggctctggatacactggaccttccgactgt
gactctggctatacctgtgtcccggtgaaccaatggtaccaccagtgccaacccggtagc
tccgcccccaccaaccctcccaatccccctgtcgctactaccactaccactgcgcccagg
cccaccaacagtgcttgcccaggcgccgtcaccaagttccgctacttcggtgtcaaccaa
gctggtgctgagttcggcagcaacatcatccccggagagctcgggacccactacatctgg
cccgcccctagttccatcgacttcttcgttaacgaaggtttcaacactttccgaattccc
ttccaattggagcgactgaacccccctgctcgtgggttgaccggttccttcgagcagccc
tacctccaggacttgaagaggactgtcgactacatcacccgaaacaagaactctttcgcc
atcatcgaacggtggaggaaccttgcaactgaattcagggataatgacaaggttatcttt
gatgtcatgaacgagccccacactatggatgctcgtgtcgttttcgacctcaaccaagcg
gcggtcaatgctatccgtgaagctggtgctacccgccaattgatcctcgttgagggaacc
tcctggaccggtgcctggacctggactaccaccagcggaaacggcaacgtcttccagaat
atccgtgatcccaacaacaatgtcgccattcagatgcaccagtacctcgacagtgacggt
tcgggtacctctcccacttgtgtttccagctccatcggtcgcgagcgtctcgctgctgcc
actgcctggttgaagcaacacaacctcaagggcttcctcggtgaactcggtgctggttcc
aaccccacttgcattgaggccatcaagggtgctctctgctccctccaggagtctgatgtc
tggattggttgggcctggtgggctgctggtccctggtggggcaactacttccaatccatt
gagccccccaatggacccgctctcgctcagatgtaccctcaggccatcaaacccttcatc
taa

DBGET integrated database retrieval system