KEGG   Coprinopsis cinerea: CC1G_06417Help
Entry
CC1G_06417        CDS       T01275                                 

Definition
CMGC/CLK protein kinase
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
cci  Coprinopsis cinerea
Brite
Enzymes [BR:cci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CC1G_06417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 541 aa AA seqDB search
MSAAVHPLNPHHISHYSRSNLPAVTQSIAGPSVMANASPVTTRKRKRAHQYTVSYSEVKE
LDSDGKVREVIVIEDTPPPPTLSPATTHNGGYSASYQPPALAPIRTRARAAAEAQAMSSS
SSSVLTAPAPKKRKRDHQDEVRAPPAKKAAAGGQQSNATNAANAWDNRTVAATDDSSKGA
PPCDDKEGHYIIVPDDMIFKRYRTVRLLGQGTFGKVVEAIDTQTNNRVAIKIIRAIPKYR
DASKIEVRVLQKLKERDPLNRNKCIHLLHWFDHRNHICLVSELLGMCVYDFLKENDFAPF
PRHHIQDFARQLFGSVAFLHELRLIHTDLKPENILLVHNDYRTINVPIPGKRNGATKPKK
ILNSTEIRLIDFGSATFESEYHSTVVCTRHYRAPEIILGLGWSFPCDAYSLGCILVEFYT
GLALYQTHDNLEHLAMMEMVMGKMPERFARAGARSKPEFFKEGAKLDWPKAKSTRQSKKD
VKSTRPLALTARQDVIPPYDHINRQFLNLVQKLLAFDPAQRITVREALAHPYFSLTIPEE
N
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcggcggtccacccgctcaaccctcaccatatttctcattattctcgttcaaac
ttgcccgcagtaactcaaagcatcgctgggcccagcgtcatggccaatgcgtctccagtc
acaaccaggaagcgcaaacgcgcccaccaatacaccgtcagctacagcgaagtcaaggag
ctcgacagcgacggcaaggtcagggaggtcatcgtcatcgaggacactccccctccacca
actctctcacccgccacgacacacaacggtggttactcagcctcctaccagcctccagcg
ttagctcctatccgcacacgagcaagagcagcagcagaggctcaggcaatgtcttcgagc
tcttcgtccgtcctgacagcccccgctccaaagaagcgaaagcgggatcaccaggatgag
gtccgtgcgccccctgcaaagaaagccgctgctggtggccaacagtccaatgcaaccaat
gccgccaatgcatgggacaaccggaccgttgctgctaccgacgactcatctaaaggcgct
cctccatgtgacgacaaggagggccactacatcattgtcccagacgacatgattttcaag
cgctatcgcacggtgcggctgctaggacagggcaccttcggtaaggtggtggaagccatt
gacacacaaacgaacaaccgcgttgctatcaagattatccgggccatccctaaataccgc
gacgcaagtaagattgaagtgagggtcctccagaaactcaaggagcgtgatcctctcaac
cgaaacaaatgtattcacctcctacactggtttgaccatcgcaaccatatatgtctcgtc
tccgagcttctggggatgtgcgtctacgatttcttgaaggagaacgactttgctcccttc
ccccggcaccacatccaagattttgccagacaattgttcggcagtgtcgcattcctgcat
gaactcaggttgatccacaccgacttaaaacccgagaatatccttctcgtccacaatgac
tacagaaccatcaatgtacctatccctggcaagcgcaacggtgccacaaaacccaagaaa
atcctcaactcgacagagattcgcttaatcgactttggctcagcgaccttcgagtcagaa
taccactccacggtggtatgcacgcgtcattaccgtgcacccgagatcattcttggtctt
ggttggtcgttcccctgtgatgcttattcgctagggtgcatcctcgtcgagttctacaca
gggttggcactgtaccaaacccacgacaacctggagcacttggcgatgatggagatggtc
atgggcaaaatgcctgaacggttcgctcgagctggtgctcgttccaagcccgagttcttc
aaagaaggcgccaaactcgattggccgaaggcaaagtcaacacgacaaagcaagaaagac
gtcaagtcaactcgtcctctggcgctgacggcacgacaggatgtcatccccccatatgac
cacatcaaccgacaattcttgaacctggtgcagaagctactggcctttgatccagcacag
aggatcactgtcagagaagcgctcgcccacccctacttctctctgacaataccggaagaa
aactaa

DBGET integrated database retrieval system