KEGG   Coprinopsis cinerea: CC1G_06515Help
Entry
CC1G_06515        CDS       T01275                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
cci  Coprinopsis cinerea
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 134 aa AA seqDB search
MSWQTYVDTNLVGSGRVTHAAIIGLQGGVWASSPGFNLTAEEQQALISAAKGALSGDEAG
ASQLQASGLRLQNEKYFTLRVSERSAYLKKQADGAIVVKTKQAILVAVYVAPLQAAEATP
VVESLADYLVSVGY
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggcaaacctacgtcgacaccaacctcgtcggaagcggccgcgtcacgcacgcc
gccatcatcggtctgcagggcggcgtctgggcttcttcccctggttttaacctcaccgcc
gaagaacaacaagccctcatctccgccgccaagggcgccctctcaggcgacgaagccggc
gcctcccaactccaagcctccggcctccgcctccaaaacgagaaatacttcaccctgcgc
gtgtcagagcggagcgcctatctgaagaaacaggccgacggagcgatcgtcgtcaaaacc
aaacaagccatcctcgtcgccgtctacgtcgccccgctccaagcagcagaagccaccccc
gtcgtggagagcctcgctgactacttggtttccgttggctattaa

DBGET integrated database retrieval system