KEGG   Coprinopsis cinerea: CC1G_06579Help
Entry
CC1G_06579        CDS       T01275                                 

Definition
acyl-CoA desaturase 1
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cci  Coprinopsis cinerea
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CC1G_06579
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CC1G_06579
Enzymes [BR:cci01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CC1G_06579
Lipid biosynthesis proteins [BR:cci01004]
 Desaturase
  First
   CC1G_06579
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 255 aa AA seqDB search
MPPLIGFFWGDALGAFVWAGLVARLFIWHCTFLVNSFAHMHGLQPYSDEDTSRGNLVRAS
SSGPRDNQRLKCSKLLALLTGGEGNHNFHHSFPHDFRSGPSNLDWDPSKWIIIGLHHLGW
VSGLRKAREIDVTDSLEHMKKKTLHPGVALEEEDSEWQGEVWNDAEVFTFQEKNPSRCLL
LLGGYVVDVTRYLGEHPGGAAHLRTHSIRKQGDINSTGAQWAFYGGFNNHSRAAKKRMRE
MRIAKLIEPGVNNAI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgccacccttaattggattcttttggggtgacgccttgggggcttttgtctgggcgggg
ctggtagccaggctattcatctggcactgtactttcttggtcaattctttcgcgcatatg
cacggtctacagccttattccgacgaggacacgtctcgaggaaatctagtaagggcatcc
tcctctggaccgagggataaccagaggctgaagtgttccaagctgctggccctactcacc
ggtggcgaaggaaaccacaactttcatcattccttcccccatgactttcgctctgggcca
tccaatctcgactgggatcccagcaaatggatcatcatcggtctacaccatctcggctgg
gtgtctggccttcggaaagcaagggaaatcgacgtcaccgattctcttgagcacatgaag
aagaaaactcttcacccgggcgtagctctcgaggaggaggacagcgagtggcaaggggaa
gtgtggaatgacgcggaggtcttcacatttcaggagaaaaatccttcccgttgtctactg
cttctcggcggttacgtcgtggacgttactcgctatctcggggaacatcccggaggagcg
gcccacttgcgaactcattccatacgaaagcaaggtgatattaattctactggcgcacag
tgggcgttctatggaggtttcaacaaccattcgcgagccgccaagaaaaggatgagggaa
atgaggatcgcgaaattgattgaacctggggtaaacaacgcgatatga

DBGET integrated database retrieval system