KEGG   Coprinopsis cinerea: CC1G_06612Help
Entry
CC1G_06612        CDS       T01275                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cci  Coprinopsis cinerea
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CC1G_06612
Enzymes [BR:cci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CC1G_06612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 403 aa AA seqDB search
MGNMKTVTLFLSLISSTFTLVGAQAQEPTTWFEKYGPQLDLSYTGPLSFAHLPYRLCLQE
NATFDVAILVSYRPGARFGPSAIRSGSRRQSDVLAYSLSWGFNPYTQGYSILDCGDVPVN
SFDNTLALDQMEVAYSTLLRRPIAREDTLAGPLKGKDGLVHPRVVSLGGDHTIVLPILRS
LYKVYGPITVIHFDAHLPMKPGLHAARQDTWPTLQLSGIDTEQSRITHGSFFYVAHEEGL
LANNSIHGGIRTPLSGPEDLANDSVVGFQVITSDDIDSLGIPEIVRKMRARVGDSPVVDI
DVIDPGMAPATGTPEAGGWTTREFKRILRGLKGLNFIGADLVEVSPAYDQGLLSAFFNVC
MSDLLVFYIACTPESQFPRLYPERADLDPTVPWLLVHYMELNG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggggaacatgaaaacggtcacgctgtttctttctttgatctcgtcgactttcactctg
gttggtgcgcaagcccaagagcctacgacttggttcgagaaatatggacctcagcttgac
ttgagctacacgggtcctctctcttttgctcatctaccctaccgactttgtctacaggag
aatgcgaccttcgatgttgcgatcctcgtttcgtatcgaccgggggctcgctttggacct
agcgccattcgctcgggaagtagaagacagagtgacgttcttgcatattcgttgtcgtgg
gggttcaatccttacacccaagggtattcgattctggattgcggtgatgtgcctgtcaac
tcattcgacaatactctcgcactggaccagatggaggttgcgtactcgactttgctacgg
aggcctattgcgagggaggacactttggcgggaccgcttaaaggcaaggatgggttggtt
catcctcgggttgttagtcttggaggtgaccatacaatcgtccttcccatcttgcgctcg
ctgtacaaggtctacggacctatcactgtcatccacttcgacgctcatctgccgatgaaa
cccggcttacatgcagcacggcaggacacttggccgacactccagctcagcggtatagac
acggagcaatctcgaatcacacatggatccttcttttacgtcgcacacgaggaagggttg
ctcgccaataacagtattcatggtggcatcaggacacctttgagtggaccagaagatctt
gccaatgactctgtggttgggttccaagttatcactagcgacgacatcgatagcctcggc
atccctgaaattgttaggaagatgagggctcgtgttggggatagccccgtcgtggacatt
gacgttattgaccctggaatggcaccagcaactggaaccccagaagccggaggctggact
acgcgagagtttaagcgcattctcagaggtctgaaaggactaaacttcattggtgcagat
ctggtggaggtttccccggcctatgatcaaggtctgctttctgcttttttcaacgtttgc
atgtctgacctgttggtattctacattgcttgtactcctgaatctcaattccctcgattg
taccctgagcgcgcagatctagatccaactgtgccctggctcctggtacactacatggaa
ttgaacggatag

DBGET integrated database retrieval system