KEGG   Coprinopsis cinerea: CC1G_06620Help
Entry
CC1G_06620        CDS       T01275                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
cci  Coprinopsis cinerea
Pathway
cci00630  Glyoxylate and dicarboxylate metabolism
cci01100  Metabolic pathways
cci01110  Biosynthesis of secondary metabolites
cci01200  Carbon metabolism
Module
cci_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CC1G_06620
Enzymes [BR:cci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CC1G_06620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 6005711
NCBI-ProteinID: XP_001829283
UniProt: A8N325
Position
1
AA seq 576 aa AA seqDB search
MLSAGRALRAPAWTRNARAMSSAATTTNVNIQPLPLDTPSLQDETALFEARVRDMEDFFS
SPRFKGIKRPYTAANIVSKQGSMPVLPQPGSVLADKLFGVLRRAAKEGRPVHTMGAIDPV
QMTQMARYQEVVYVSGWAASSVLTTGNNEVGPDLGDYPYTTVPNQVHRIFRAQQLHDKKN
YDERMSATPEQRAKMENVDYLRPIIADADTGHGGLSAVMKLVKLFVESGASGIHLEDQLH
GGKKCGHLGGKVLVPTSTHISRLIAARFQTDLMKSTMLLIARTDSESGKLISSTVDAADH
EFILGTTRKESQSLAQVLSEAEARGASGAEIDLLEKQWMDRHKLCTFNQAVEKAIEESDI
KDKKGAYETYVSAVEGKSNGEAREVAAEILGKPVFWDWDLPRTREGYYHYTGGIEAAIKR
SIAFAPYADLLWLETKSPNVEQAAGFARKIREQYPGKWLVYNLSPSFNWSHHGFSDTDLK
NFVWDLGKEGFVLQLISLAGLHSNAVTTAELAKRFKDEGMLAYVELIQKKEKAIGCDVLT
HQRWSGANYIDRILQTVSAGSSSTSAVGKDSTEHTF
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccgcgggaagggcactgcgagccccagcttggactcgtaacgcaagagccatg
tcgtcggcagcaacgacgaccaatgtcaacatccaacccctccctctcgacacgccatcc
ctccaggatgaaaccgccttgttcgaggctcgcgttcgggacatggaggacttcttctcg
agtccaaggttcaagggaatcaaacgtccctacaccgccgccaacatcgtctccaagcaa
gggtctatgcccgtattgcctcagccaggttccgtgctcgcagacaagctctttggcgtg
ctccgccgggctgccaaggagggtcggcctgtccataccatgggtgctatcgacccagtg
cagatgacccaaatggcgaggtaccaggaagtcgtatatgtctccggttgggctgcctcc
agtgtcctcaccaccggcaacaacgaagttggtccggatcttggtgattacccatacacg
actgttcccaaccaagtgcaccgaattttccgtgcccaacagctgcatgacaagaagaac
tacgatgaacgcatgtcggcgactccggaacagcgagctaagatggagaacgtagactat
ttgaggcctatcattgcagatgctgatactggtcatggtggtctttcggcagtcatgaag
ctggtcaagctcttcgtggaatctggtgcttccggtatccacctcgaagatcaattgcac
ggtggaaagaaatgcggccatcttggtggcaaagttctcgtcccaacctcgactcacatc
tcccgtctcattgccgcgcgtttccaaaccgacttgatgaagtccaccatgctactcatc
gccaggactgactctgaatccggaaaactcatttcgtcaacggttgatgcagcagaccac
gaattcatcttgggaactactaggaaggagagccagtctttggcacaggttttgtcggaa
gctgaggctcggggcgccagtggtgctgaaattgaccttcttgagaagcaatggatggat
aggcacaaattgtgcactttcaaccaagctgtcgaaaaggctattgaggaatcggatatc
aaggacaagaagggcgcctatgaaacctacgtcagtgccgtcgaaggcaaatccaatggc
gaagcacgcgaggttgctgctgaaatccttggaaaacctgtcttctgggattgggacttg
ccacgcactagggaaggttactaccactacactggcggaatcgaggctgctatcaagcgg
agcattgcattcgctccctacgctgatctgctgtggctcgagaccaaatcacccaacgtt
gaacaagccgctggtttcgctcgaaagatcagggaacagtaccccggaaagtggttggtg
tacaacctcagccccagcttcaactggtcccaccatggtttctcagacaccgacttgaag
aactttgtctgggaccttggcaaggaaggatttgttcttcaattgatttccttggcaggc
cttcacagcaacgccgttacaaccgctgaacttgccaagcgattcaaggacgaaggcatg
ttggcttatgtcgaactcattcaaaagaaggagaaggccattggatgcgatgtccttacc
caccagagatggagcggcgcaaactacattgacagaattctccagaccgtgtcagcaggc
tcgtcgagcacatccgctgtcggaaaagattcgacagaacacacgttctga

DBGET integrated database retrieval system