KEGG   Coprinopsis cinerea: CC1G_06756Help
Entry
CC1G_06756        CDS       T01275                                 

Definition
(RefSeq) cap binding protein
  KO
K03259  
translation initiation factor 4E
Organism
cci  Coprinopsis cinerea
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cci00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CC1G_06756
Messenger RNA biogenesis [BR:cci03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     CC1G_06756
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CC1G_06756
Translation factors [BR:cci03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CC1G_06756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 301 aa AA seqDB search
MSANSTLPGPALQASRAALSAALADQEAANTQPSKSKDESTEPGEIQEVVVDMQSQADAI
RTVFSDPTNFNVKHPLFSAWTLWFDSPSTKGRNLPQTPVSAFPQTPVLQTPGAAAAQGWM
EDIKRVISFDSVEEFWGLYNNIIPPSQLPQKANYYLFKDGIIPAWEDEANKYGGKWSIQL
PKDKNRNNVDKMWLHTMLAAIGETFDPSPSGNNSESLITGVIVSTRPQFYRLSIWTRLAP
GLGEEDAKLRERIEAIGRHFKVQVLAYPESARLAGPLATEVEFQSHKDSEKKGKSVRKII
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaactccactctccccggccctgccctccaagcttcgagagctgcgctctca
gcagctctggccgaccaggaggctgccaatacccagccctcaaaaagcaaagatgaaagc
accgaacctggcgagattcaggaagtagtggttgatatgcagagccaagcggacgcgatc
cgaacggttttcagcgaccctactaatttcaacgttaaacatcccttgttttctgcttgg
actctttggttcgattcgccatcaaccaaaggtcgaaatctacctcagaccccagtctct
gcctttccccaaacccctgttctccagacgccaggagcagctgccgcacaggggtggatg
gaagacatcaagagagtgattagcttcgacagcgtcgaggaattctggggcctgtataac
aacatcatccctccatctcaactccctcaaaaggcgaactactatcttttcaaggatggg
attatccctgcctgggaagatgaggccaacaagtatggcgggaaatggagcattcaattg
cccaaggacaagaaccgaaacaacgtcgacaagatgtggctgcacaccatgcttgctgcg
atcggcgagacctttgaccccagtcctagtggcaacaactcagagtcattaatcacaggg
gtgattgtatcgacgcgtccgcagttctaccgactttcgatatggacccgacttgcacct
ggactgggcgaagaagatgcgaaattgcgggagaggattgaagcgattgggcgacatttc
aaggtgcaggtgttggcgtacccggagagtgcgcgccttgcagggcctcttgcgactgaa
gttgaattccagtcgcacaaagactctgagaagaagggcaagtctgtgcggaagatcata
gtgtaa

DBGET integrated database retrieval system