KEGG   Coprinopsis cinerea: CC1G_06756Help
Entry
CC1G_06756        CDS       T01275                                 

Definition
cap binding protein
Orthology
K03259  
translation initiation factor 4E
Organism
cci  Coprinopsis cinerea
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:cci03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 301 aa AA seqDB search
MSANSTLPGPALQASRAALSAALADQEAANTQPSKSKDESTEPGEIQEVVVDMQSQADAI
RTVFSDPTNFNVKHPLFSAWTLWFDSPSTKGRNLPQTPVSAFPQTPVLQTPGAAAAQGWM
EDIKRVISFDSVEEFWGLYNNIIPPSQLPQKANYYLFKDGIIPAWEDEANKYGGKWSIQL
PKDKNRNNVDKMWLHTMLAAIGETFDPSPSGNNSESLITGVIVSTRPQFYRLSIWTRLAP
GLGEEDAKLRERIEAIGRHFKVQVLAYPESARLAGPLATEVEFQSHKDSEKKGKSVRKII
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaactccactctccccggccctgccctccaagcttcgagagctgcgctctca
gcagctctggccgaccaggaggctgccaatacccagccctcaaaaagcaaagatgaaagc
accgaacctggcgagattcaggaagtagtggttgatatgcagagccaagcggacgcgatc
cgaacggttttcagcgaccctactaatttcaacgttaaacatcccttgttttctgcttgg
actctttggttcgattcgccatcaaccaaaggtcgaaatctacctcagaccccagtctct
gcctttccccaaacccctgttctccagacgccaggagcagctgccgcacaggggtggatg
gaagacatcaagagagtgattagcttcgacagcgtcgaggaattctggggcctgtataac
aacatcatccctccatctcaactccctcaaaaggcgaactactatcttttcaaggatggg
attatccctgcctgggaagatgaggccaacaagtatggcgggaaatggagcattcaattg
cccaaggacaagaaccgaaacaacgtcgacaagatgtggctgcacaccatgcttgctgcg
atcggcgagacctttgaccccagtcctagtggcaacaactcagagtcattaatcacaggg
gtgattgtatcgacgcgtccgcagttctaccgactttcgatatggacccgacttgcacct
ggactgggcgaagaagatgcgaaattgcgggagaggattgaagcgattgggcgacatttc
aaggtgcaggtgttggcgtacccggagagtgcgcgccttgcagggcctcttgcgactgaa
gttgaattccagtcgcacaaagactctgagaagaagggcaagtctgtgcggaagatcata
gtgtaa

DBGET integrated database retrieval system