KEGG   Coprinopsis cinerea: CC1G_06806Help
Entry
CC1G_06806        CDS       T01275                                 

Definition
dihydrolipoyllysine-residue acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cci  Coprinopsis cinerea
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CC1G_06806
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CC1G_06806
   00020 Citrate cycle (TCA cycle)
    CC1G_06806
   00620 Pyruvate metabolism
    CC1G_06806
Enzymes [BR:cci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CC1G_06806
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 454 aa AA seqDB search
MPVSLVRVLSRGLHVSARRHALSQFNMPAMSPTMTEGGIASWKKKEGEAFSAGDVLLEIE
TDKATIDVEAQDDGILAKILAQDGSKAVPVGSVIAIIGEEGDDLSGAAALAEEAASKPQA
SPPKAEEKAPEQPKPQPTPAPEPVKVESKESLPKGDRIFASPIAKKIALERGIPLAKVKG
TGPSGRIIREDVEKWKAPEAAAPAASATTAAAAAQPSVPSTDYVDTPVSNMRRTIGARLT
QSKQELPHYYLTAEINMDKVLKLREVFNKTLGEKDKSAKLSVNDFIVKATACALSDVPEA
NSAWLGEVIRTYKKADISVAVATPTGLITPIVKDAGAKGLASISAETKALAKKARDGKLA
PAEYQGGTFTISNLGMYGIDHFTAIINPPQSCILAVGATQARLVPAPEEERGFKTVQVMK
VTLSCDHRTVDGAVGARWLNAFKGYLENPLTFML
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtctccctcgttcgcgttctttcgcgcggcctccatgtttcggcccgccgtcat
gcgctgtcccaattcaacatgccagcaatgagtccgacaatgaccgagggtggtattgct
tcctggaagaagaaggagggtgaagctttcagcgcaggcgacgtcctcctcgagattgaa
accgacaaggctacaattgacgtagaggctcaagatgatggtatcctcgctaaaatcctt
gcccaagacggttcaaaagccgttcctgttggctccgtcatcgccatcattggtgaggaa
ggtgatgacttgtccggtgctgctgcccttgcagaggaagccgcctcaaagcctcaagca
tcaccacccaaggcagaggaaaaggctccagagcaaccaaaacctcagcctacacctgcc
cccgaacctgtcaaggtggagagcaaggagtccctgcccaagggcgaccgcatctttgca
agccctattgcaaagaagattgccctcgaacgtggcattcctttggccaaggtgaagggc
actggtccttcaggtcgcatcattcgtgaggatgtcgagaaatggaaggcacccgaggcc
gctgcacctgctgcatccgccaccaccgctgctgccgctgcccaaccttctgttccctcc
accgactacgttgacacacccgtctccaacatgcgccgcaccatcggtgcccgtctcacc
cagtccaagcaagagcttcctcactactacctcaccgccgaaatcaacatggacaaggta
ctcaaactcagggaagtcttcaacaagaccctcggcgagaaggacaagtctgccaagctc
agtgtcaacgacttcatcgtcaaggctactgcttgcgccctttctgacgtgccagaggcc
aactctgcgtggttgggcgaggtcatcagaacatacaagaaagctgacatctcggtggcc
gtcgctacccccacgggtctcattacacccatcgtgaaggatgcgggtgccaagggtctt
gcctcgatctccgcagagaccaaggcccttgcaaagaaagctcgcgatggcaagcttgct
cccgctgaataccagggtggtactttcaccatctctaacctgggcatgtacggtatcgac
cacttcaccgccatcattaacccccctcaatcctgcatcctcgccgtcggcgcaacccaa
gctcgtctcgtacccgcacctgaggaagagcgtggctttaagacagttcaggtcatgaag
gttactcttagctgtgaccaccgtactgtcgatggtgctgttggtgcccggtggttgaac
gcgttcaagggctacctcgaaaatcctctgaccttcatgctatag

DBGET integrated database retrieval system