KEGG   Coprinopsis cinerea: CC1G_06821Help
Entry
CC1G_06821        CDS       T01275                                 

Definition
phospholipase B
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
cci  Coprinopsis cinerea
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CC1G_06821
Enzymes [BR:cci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CC1G_06821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 725 aa AA seqDB search
MLVLGVLPPTLLGYTLLYLTRLCNGQVIPVLNQQSPTDYAPIANVDCPDISTNPLVRQFP
PENQTLHPAEVEYVETRASTVLPGAWADWLGDGSALGYDLTAFEGNFPKVGIAIPGGGLR
AAQYGAACLNALDARNNSAKAAGTGGLLQVASYMTGLSGGSWITASLFFNDWPTLNDLVF
GHNGLNGWRLDTPLVTPDGSNILSKANQWYFGSILWSVMAKAKFVDTSLTDPWSRMISYH
FLNQTTRDNIFSNETAHGAGQLWSKVPELDSYKEFRAPFPMIVANARPVGSNATTILSLD
ATVYEITPLELASYDPGLSAGMNLTYAGTHLNNGRPENGSACMVGFDQVGFVMGTSASLF
NQLFDFARNTINGFSESDEGGLLYVLGRQLRAVRTRADDVANWPSPFQGLREDTFQDSDA
NWLELIDGSSNQENVPYGPLFVKARGLDVIVTAEGSADIPGLNWPNGSSLITTKQRQETI
LRLTHQAFPPIPKTPQEFIETGVNARPTFFGCDPSTPSDYPLVIYLPNAPPVNGDDPHSN
TATFQLSYTLKHTRLMFDQIHTNLISGFKPDTNDADPDWGICLQCAAIDRARFKVSPTVE
RSEKCTECFQRYCYDPQNPPSKSQLPNRKLEFVDPDPQGFDRLGGFFHRNRFALIGGLIG
LIVFIAGLIVGLLWWKKNRDRKRDYQRVLALHQDDDDPLFQHGHYSSYEMHQKYASDTSY
DPPKP
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgctgggtgtcctaccaccaactctcctgggctacactctcctgtacctcact
cgcctatgcaacgggcaggtaattcctgttctgaaccaacagtctccgacagattacgcg
cccatagccaatgtcgactgccccgacatttccaccaacccactggtccgccaattcccc
ccagagaatcaaacacttcacccagccgaagttgaatatgtcgaaacacgggcgtccacc
gtcctcccaggcgcttgggctgattggctcggggatggatcagcgcttggatacgacttg
accgcattcgagggcaactttccgaaagtagggattgccatcccgggtggcggcctgagg
gctgcacagtacggtgccgcctgtctgaatgcactcgacgccaggaacaattctgcaaag
gctgcagggacgggtggtctcttgcaggtcgcttcgtacatgactggtttatcaggtgga
agttggataacagcctccttgtttttcaatgactggcccaccctcaatgacctcgttttc
gggcataacggtctcaacggatggagactcgacactcctctcgtaacacccgatggatca
aacatcctctccaaagccaaccaatggtactttggtagtatcctttggagcgtaatggct
aaagcgaaattcgtcgataccagtttgacagatccatggtcccgaatgatttcctaccac
ttcttgaatcaaacgacccgtgataacatctttagcaacgaaacagcccacggtgcaggc
cagctctggtccaaagtcccagagctcgactcttacaaagaattccgtgctccattccca
atgatcgtagcaaacgctcgtccagttgggtcaaatgcgacaactattctgtcattggat
gctacagtctacgagatcacacccctcgagttggcatcctacgacccaggtctatcagcg
gggatgaacctgacctacgcgggcacgcatctcaacaatggtcgcccagaaaacggctcg
gcgtgcatggtgggttttgaccaagtagggttcgtgatgggaaccagtgcaagcctgttc
aatcaactctttgactttgcccgcaataccattaacggattctccgaatccgacgaaggg
gggttactatatgttcttgggcgccaactccgtgccgtgcgaacacgtgcagatgatgtt
gccaactggccgagtcctttccagggcctgagggaggacacattccaggacagtgacgcg
aactggctagaacttatcgacgggtcttctaaccaagaaaatgtaccttacggtccactg
ttcgtcaaagcacgcgggttggatgtgatcgtcactgcagaaggaagtgcggacattcct
ggtctcaactggccaaatggaagtagtttgatcacaacgaagcaacgacaagaaaccatc
cttcgtctcacccatcaggcgttccctcctatccccaagacgccccaagaattcatcgaa
acaggtgtaaacgcccgacctacgttctttggttgcgacccgtcgacgccatccgattat
ccgctcgttatttacctccccaacgcgccccctgtcaatggcgatgacccgcattccaac
acagcaaccttccaactatcatacacgctgaagcatacccgtctaatgttcgaccaaatc
cacaccaacctcatttcaggattcaaacccgatacaaacgacgcggatccagactggggc
atttgcctccaatgcgctgctatcgacagagcgcggttcaaagtctcacctactgtcgag
cgctcagagaaatgcacggaatgtttccagaggtactgttatgacccacagaacccgcct
agcaaatcccagctaccgaatcgcaagttggaatttgtcgatccagatccccaaggtttc
gatcgactgggtggattcttccataggaatcggttcgctcttattggagggttgattggg
cttatcgtgtttatcgccggtttgattgttggactgttatggtggaagaagaatcgcgat
cgtaagagggattaccagcgtgtactggcgttgcaccaggacgacgatgacccgttgttc
cagcacggacattattcttcctacgagatgcaccaaaagtatgcatcagacactagttat
gacccaccaaagccgtga

DBGET integrated database retrieval system