KEGG   Coprinopsis cinerea: CC1G_07055Help
Entry
CC1G_07055        CDS       T01275                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cci  Coprinopsis cinerea
Pathway
cci00480  Glutathione metabolism
cci00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CC1G_07055
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CC1G_07055
Enzymes [BR:cci01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CC1G_07055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx Ral Baculo_LEF-3
Motif
Other DBs
NCBI-GeneID: 6012951
NCBI-ProteinID: XP_001836408
UniProt: A8NUA0
Position
4
AA seq 133 aa AA seqDB search
MSTESSSGFYSLKAELPNGQTYDFEQLRGKVVLIFGGQEPADDAGIQEFCTVNHGVTFPL
MKKSEVNGDNTNEVYQWLKSKKAGFLGLTRIKWNFEKFLVDKEGNVVNRWASTTSPSSIA
SEIEKLLTEEPRL
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgaatcatcttctggcttttactctctgaaggctgaactgcccaatggacaa
acctacgactttgaacaacttcgtggcaaggttgtgttgattttcggtgggcaagaacct
gcggacgatgctggtattcaagaattctgcacggtgaaccatggcgtcactttccccctt
atgaagaaatccgaggtgaacggagacaacaccaacgaagtttatcaatggctaaagagc
aagaaggctggtttcttgggcctcacgagaatcaagtggaactttgaaaagtttttggtc
gacaaggagggaaatgttgtgaatcgctgggcctcaaccacatccccttcgtctatcgcc
tctgagattgagaagctgttgaccgaggaaccgagattgtag

DBGET integrated database retrieval system