KEGG   Coprinopsis cinerea: CC1G_07055Help
Entry
CC1G_07055        CDS       T01275                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cci  Coprinopsis cinerea
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CC1G_07055
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CC1G_07055
Enzymes [BR:cci01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CC1G_07055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 133 aa AA seqDB search
MSTESSSGFYSLKAELPNGQTYDFEQLRGKVVLIFGGQEPADDAGIQEFCTVNHGVTFPL
MKKSEVNGDNTNEVYQWLKSKKAGFLGLTRIKWNFEKFLVDKEGNVVNRWASTTSPSSIA
SEIEKLLTEEPRL
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgaatcatcttctggcttttactctctgaaggctgaactgcccaatggacaa
acctacgactttgaacaacttcgtggcaaggttgtgttgattttcggtgggcaagaacct
gcggacgatgctggtattcaagaattctgcacggtgaaccatggcgtcactttccccctt
atgaagaaatccgaggtgaacggagacaacaccaacgaagtttatcaatggctaaagagc
aagaaggctggtttcttgggcctcacgagaatcaagtggaactttgaaaagtttttggtc
gacaaggagggaaatgttgtgaatcgctgggcctcaaccacatccccttcgtctatcgcc
tctgagattgagaagctgttgaccgaggaaccgagattgtag

DBGET integrated database retrieval system