KEGG   Coprinopsis cinerea: CC1G_07493Help
Entry
CC1G_07493        CDS       T01275                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
cci  Coprinopsis cinerea
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cci00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CC1G_07493
Enzymes [BR:cci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CC1G_07493
Peptidases [BR:cci01002]
 Metallo Peptidases
  Family M67
   CC1G_07493
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 652 aa AA seqDB search
MNQAGNGHGHRRHPKRPASIAELADKALEHGWDDGRDLKHYLRMAEKYRKEGKDFAKQGD
LESAFVLLAKAATLVLEKLPTHRDYQTLLNPAQRNNLALNGQDILDHLSELKPILVDRFD
KWLKAHPDGLDHDQTPEPPKSAALQQDDARAQAQAQAQAQANAARFQEEERMRASQRDQQ
RRVQEEAALWRQQREEIIRRGDAETKERQKAAAVAAARQAANPGSYGSQHTAVVHIPPPP
AAVRHQQQQDEFRRREEEINRRKRRQEQDAIAQRQQAADDAARAMRQTIPTAVTPAGVPV
APLYPQTTPTPNSARSYQNYPVSHPSSVVPPAPYSAPAYSTTPSHSEGPSIMPLENPLRY
EGDSTDSESVHHDFHRRISKQRHHTASPRAPVPNSAAIPPITTTSPPPQLRIDYPRLMSP
HQQKQGYYPSLNSMFMPEPSNNATPSLLFDSNGLYPQNMLPSHAQPYNQSRPPLPPPPPN
QNQYPNYPGPTRPPPPVPTAPPTATQPQPSEPDRISRERSREPGSGRPPLKQVNFPRECL
PRFLAIAKANTMNNKETCGLLLGKDKGHKYVVTTLLIPKQHSTSDTCTMDEEQLVLEFTE
ERSLITLGWIHTHPSQSCFMSSVDLHTHSGFQRMLPESFAVVCAPNSRPNDY
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaggctggaaatgggcatggacaccgacgacaccccaagcgaccagcgtcgata
gcagagttggctgacaaggcactcgagcacggctgggacgacggcagagatctcaagcac
taccttagaatggcagagaagtaccgaaaggaaggaaaggactttgccaaacagggcgac
ctcgagagtgcttttgtcttgctggcaaaggccgccaccctcgtgctcgagaaattaccg
acacaccgggactatcaaacgttgctgaacccagcccagcggaataatttggcgctgaat
ggtcaagatatcttggatcacctcagtgaactcaaaccaattctggtggatcgatttgac
aagtggttgaaggcgcatccggatggccttgaccacgatcagacgcctgaaccaccgaag
agtgctgcactacagcaggatgatgccagagcgcaggcacaggcacaggcacaggcacag
gcgaatgctgcacggtttcaggaggaagagaggatgcgggcgagtcagagggaccaacag
cgtcgcgtgcaagaggaagctgctctgtggcgccaacaacgggaagagataattcgtcgg
ggcgacgctgagacgaaggagcggcagaaggctgccgcagtagctgctgctcgccaagct
gcgaatcccggatcatacggttcacagcatactgcagttgtgcacataccacctccccct
gcggctgtcaggcatcagcagcagcaagacgagttccgcagacgtgaagaagagatcaat
cgtcggaaacgaaggcaggaacaagatgccattgctcaacgtcagcaggctgccgacgac
gcagccagagcgatgcgccaaaccattccaactgccgttacacctgccggggtcccagtc
gcgcctctctatccccagacaacgccaacgccgaactctgctcgttcataccaaaactac
cctgtctcacatccttcctctgtcgtaccccctgccccttactcggcacccgcatactcg
acaaccccatcgcattcagaagggccatctatcatgcctctcgagaacccccttcgatac
gaaggcgactcaacagattccgaatccgtccatcacgacttccatcgacggattagcaaa
caacggcaccatactgcctcccctcgtgccccagtgccaaactctgccgccattcccccc
atcactaccacttcacctccacctcagctcagaatcgactatcctcgtctcatgtcgcct
catcagcagaaacagggttattacccgtccctcaactcaatgtttatgccagagccatct
aataacgcaacaccctcgttactgtttgattccaatggcctatacccacagaacatgtta
ccttcacatgcacaaccctacaaccaatcacgtccgccgttgccgccacctccaccgaac
cagaatcaataccccaactatcctgggccaacaagaccaccccctcccgttcctacagcc
ccgccaaccgcaacgcaacctcagccctcagaaccagatcgcatttcccgcgaacggtcg
cgagagcctggatccggtcgacctccgctcaagcaggtcaacttccctcgcgagtgtctg
ccacgctttttggcgattgctaaagccaatactatgaataacaaggagacttgtggacta
ctccttgggaaggacaaaggtcacaagtatgttgttacgacgctgttgatcccgaagcag
cattcgacgagcgacacttgcacgatggacgaggagcagttggttctcgagtttacggaa
gagaggagcttgattacgcttggatggatacacactcatccttcgcagtcatgcttcatg
tcctccgtcgaccttcacacccattcgggtttccaacgcatgttgcctgaatccttcgct
gttgtttgcgcacctaattctcggccaaatgactactag

DBGET integrated database retrieval system