KEGG   Coprinopsis cinerea: CC1G_07578Help
Entry
CC1G_07578        CDS       T01275                                 

Definition
polyA+ RNA export
Orthology
K14298  
mRNA export factor
Organism
cci  Coprinopsis cinerea
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cci00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CC1G_07578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 356 aa AA seqDB search
MSFFGAGSSTTAGTSTTAPVEKDVEVADPPTDSISSLSFSPQAEYLAVASWDQSVRIYEV
GPQGQTQGKAMYQHQGPVLDVCWNNDGTKIFSGGADNAGRMFDVTTGQATQVAQHDAPVK
VVGWVNTPQAGILATGSWDKTIKYWDLRTPNPVATVTLPERCYTFDIQFPLMVVGTAERR
IQIYNLSNPTTVYKELLSPLKWQTRVVSCITASEKSGFAVGSVEGRVAVHYVEDKDAANN
FSFRCHRRDSTPNSKDQSQIFAVNSMAFHPVHGTLATCGSDGTMHFWDIEARTRLKSFDP
APGPISTGGFNRNGTLFAYAISYDWSKGHSGMTPGHPNKLMLHPCKEEEVRKRSRK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttctttggagcgggcagttcaaccacggcgggaacgagcactacggcgccggtc
gaaaaggatgtcgaagttgctgacccgccgacggactccatctcgtcgctctcgttctca
ccacaggcagagtacctcgctgttgcaagttgggatcaaagtgttcggatatacgaagta
ggacctcagggacagacgcagggcaaggccatgtatcaacatcaaggccccgtgctggac
gtctgttggaacaacgacggcacgaaaatcttctctggaggcgctgacaatgcagggaga
atgttcgacgtgacgactggccaggctacacaggttgctcagcatgacgcccctgtaaag
gtcgtaggctgggtcaacacccctcaggccggaattttggcgactgggagttgggacaaa
acgatcaagtattgggacttgcgaacacccaaccctgtcgcgacagtcactctcccagag
cgatgctacactttcgacatccaattccctctgatggttgttggaacggccgaacgacgc
attcagatttataatctcagtaaccctaccactgtctacaaggagttgctgtcgccgttg
aaatggcaaacacgagtggtctcgtgtattaccgcatcagaaaagagcggatttgcggtt
ggaagtgttgaagggcgagtggctgttcactatgtcgaagacaaagacgcagcgaataac
ttctcgttcagatgccatcgccgagactctactcccaactccaaagaccaatcgcagata
ttcgctgtaaattccatggctttccatcccgtgcatgggacgctagcgacatgcggttct
gatggtaccatgcacttctgggacatcgaggcaagaacgagattgaagagcttcgatcct
gcccctggcccgatttctactggaggtttcaatcgcaatggtacattgtttgcctatgca
atctcgtacgattggtccaaaggacattctggtatgactccaggtcatcctaacaagctg
atgctacacccttgcaaagaagaagaggttaggaaacgcagcaggaagtaa

DBGET integrated database retrieval system