KEGG   Coprinopsis cinerea: CC1G_07639Help
Entry
CC1G_07639        CDS       T01275                                 

Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
cci  Coprinopsis cinerea
Brite
Chromosome [BR:cci03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CC1G_07639
Exosome [BR:cci04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CC1G_07639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa CENP-W Bt_P21
Motif
Other DBs
NCBI-GeneID: 6008864
NCBI-ProteinID: XP_001832379
UniProt: A8NC35
Position
9
AA seq 146 aa AA seqDB search
MAPKPASTAGKAPVSTASKAPAKPAEGAKAAKKTSKPASGADGDKKKRKKVRKETYSSYI
YKVLKQVHPDTGISNKAMAILNSFVNDIFERIATEASKLASYSKKSTISSREIQTAVRLI
LPGELAKHAISEGTKSVTKFSSAGAK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaaacccgcttccactgccggcaaggcccctgtttccaccgcctccaaggct
cccgctaagcctgctgagggtgcaaaggctgctaagaagacctccaagcccgcttctggt
gctgacggcgacaagaagaagcgcaagaaggtccgaaaggagacttactcctcttacatt
tacaaggtcctcaagcaggtccaccctgatactggtatctccaacaaggcgatggccatt
ctcaactcgttcgtgaacgacatcttcgagcgaattgccactgaggcttccaagctcgct
tcttactccaagaagtccaccatctcatcacgcgaaatccaaactgctgtccgcctcatc
ctccctggtgaactcgccaagcacgctatctctgagggtaccaagtcggtgaccaaattc
tcttccgctggtgccaagtaa

DBGET integrated database retrieval system