KEGG   Coprinopsis cinerea: CC1G_07639Help
Entry
CC1G_07639        CDS       T01275                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
cci  Coprinopsis cinerea
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 146 aa AA seqDB search
MAPKPASTAGKAPVSTASKAPAKPAEGAKAAKKTSKPASGADGDKKKRKKVRKETYSSYI
YKVLKQVHPDTGISNKAMAILNSFVNDIFERIATEASKLASYSKKSTISSREIQTAVRLI
LPGELAKHAISEGTKSVTKFSSAGAK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaaacccgcttccactgccggcaaggcccctgtttccaccgcctccaaggct
cccgctaagcctgctgagggtgcaaaggctgctaagaagacctccaagcccgcttctggt
gctgacggcgacaagaagaagcgcaagaaggtccgaaaggagacttactcctcttacatt
tacaaggtcctcaagcaggtccaccctgatactggtatctccaacaaggcgatggccatt
ctcaactcgttcgtgaacgacatcttcgagcgaattgccactgaggcttccaagctcgct
tcttactccaagaagtccaccatctcatcacgcgaaatccaaactgctgtccgcctcatc
ctccctggtgaactcgccaagcacgctatctctgagggtaccaagtcggtgaccaaattc
tcttccgctggtgccaagtaa

DBGET integrated database retrieval system