KEGG   Coprinopsis cinerea: CC1G_07689Help
Entry
CC1G_07689        CDS       T01275                                 

Definition
(RefSeq) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cci  Coprinopsis cinerea
Pathway
cci00020  Citrate cycle (TCA cycle)
cci00310  Lysine degradation
cci01100  Metabolic pathways
cci01110  Biosynthesis of secondary metabolites
cci01130  Biosynthesis of antibiotics
cci01200  Carbon metabolism
Module
cci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cci_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CC1G_07689
  Amino acid metabolism
   00310 Lysine degradation
    CC1G_07689
Enzymes [BR:cci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CC1G_07689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 GCV_H
Motif
Other DBs
NCBI-GeneID: 6008794
NCBI-ProteinID: XP_001832302
UniProt: A8NC02
Position
9
AA seq 442 aa AA seqDB search
MLSKRIIAIARGRALLKQRTVGPAFSRGWDIANGHAQRAQFHASRLIQAETIKVPQMAES
ISEGTLKSWLKQEGETVAADEEVATIETDKIDVQVNAPKSGKIVKLLASEEDTVTVGQDL
FIIEPGEVGETAAPPPAKEPEGTAAPAQETKDASEPADQQVDKKLPAPPAPSQADKTPEV
KEQVTKPKEKEDVKKSSKKESEPAPRPAAGSRTETRVKMSRMRLRIAERLKESQNAAASL
TTFNEIDMSSLMEMRKKYKDQVLKEHDVKLGFMSAFAKACSLALRDIPAANASIEGDEIV
YRDYVDLSVAVATPKGLVTPVLRNAESMNFIEIEREIAALGKKARDGKLTLEDMAGGTFT
ISNGGVFGSLFGTPIINLPQAAVLGMHAIKDKPVVVDGQIVIRPIMVVALTYDHRLLDGR
EGVTFLVKVKEYIEDPRKMLLA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgaaacggatcattgctatcgctcgaggtcgagctctgttgaagcagaggacc
gttggacccgctttttcgcggggttgggatatcgccaatggacatgctcaacgagcacag
ttccatgcatcgagactcattcaggccgaaacaatcaaggtcccacagatggctgaatct
atcagcgaaggtaccttgaaatcgtggttgaagcaggagggagagaccgttgctgcagac
gaggaggtcgccaccatcgaaaccgacaagattgacgttcaagtcaacgcgccaaagtcc
ggcaagattgtaaagttgttggcgagcgaggaggataccgttactgtggggcaggacctg
ttcattattgagccgggtgaggtcggagagaccgccgccccgccccccgccaaggagcct
gaaggaactgctgcacccgcacaggagactaaggatgcctcggaacctgcagatcaacaa
gtagacaagaaacttcctgctccccctgcgccatcacaagccgataagacgcctgaagtg
aaagagcaggttacaaaacctaaagagaaggaagatgtgaagaagagcagtaaaaaggag
agcgagcctgcccccagacccgccgctgggtcccggacggagaccagggtcaagatgtcg
cgtatgcgcctccgtatcgccgagcgtctcaaggagtcccagaacgccgctgcctcgtta
accaccttcaacgaaatcgacatgtcctcgctcatggagatgcgcaagaagtacaaggac
caggtcctcaaggagcatgacgtcaagctcggattcatgtctgcctttgccaaggcctgc
tctctcgccctccgggatatccctgccgccaacgccagcatcgaaggcgacgagatcgtc
taccgcgactacgtcgatttgagcgttgctgttgccacccccaagggtttggtcactccc
gtcttgcgaaacgcagagtcaatgaacttcattgagattgagagggagattgctgctctt
ggcaagaaggctcgtgatggcaaactcacccttgaggatatggccggcggtaccttcacc
atctcgaacggcggtgtcttcggatcgctcttcggaacccctatcatcaacttgcctcag
gctgctgtgctcggtatgcacgccatcaaggataagcccgtggtcgtcgacggccagatc
gtcatccgacccatcatggttgttgcccttacctacgaccaccgactgctcgacggcagg
gaaggtgttactttcctcgtgaaagtcaaggagtacattgaagatcctagaaagatgttg
cttgcttaa

DBGET integrated database retrieval system