KEGG   Coprinopsis cinerea: CC1G_07689Help
Entry
CC1G_07689        CDS       T01275                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cci  Coprinopsis cinerea
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CC1G_07689
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CC1G_07689
  Amino acid metabolism
   00310 Lysine degradation
    CC1G_07689
Enzymes [BR:cci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CC1G_07689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 442 aa AA seqDB search
MLSKRIIAIARGRALLKQRTVGPAFSRGWDIANGHAQRAQFHASRLIQAETIKVPQMAES
ISEGTLKSWLKQEGETVAADEEVATIETDKIDVQVNAPKSGKIVKLLASEEDTVTVGQDL
FIIEPGEVGETAAPPPAKEPEGTAAPAQETKDASEPADQQVDKKLPAPPAPSQADKTPEV
KEQVTKPKEKEDVKKSSKKESEPAPRPAAGSRTETRVKMSRMRLRIAERLKESQNAAASL
TTFNEIDMSSLMEMRKKYKDQVLKEHDVKLGFMSAFAKACSLALRDIPAANASIEGDEIV
YRDYVDLSVAVATPKGLVTPVLRNAESMNFIEIEREIAALGKKARDGKLTLEDMAGGTFT
ISNGGVFGSLFGTPIINLPQAAVLGMHAIKDKPVVVDGQIVIRPIMVVALTYDHRLLDGR
EGVTFLVKVKEYIEDPRKMLLA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgaaacggatcattgctatcgctcgaggtcgagctctgttgaagcagaggacc
gttggacccgctttttcgcggggttgggatatcgccaatggacatgctcaacgagcacag
ttccatgcatcgagactcattcaggccgaaacaatcaaggtcccacagatggctgaatct
atcagcgaaggtaccttgaaatcgtggttgaagcaggagggagagaccgttgctgcagac
gaggaggtcgccaccatcgaaaccgacaagattgacgttcaagtcaacgcgccaaagtcc
ggcaagattgtaaagttgttggcgagcgaggaggataccgttactgtggggcaggacctg
ttcattattgagccgggtgaggtcggagagaccgccgccccgccccccgccaaggagcct
gaaggaactgctgcacccgcacaggagactaaggatgcctcggaacctgcagatcaacaa
gtagacaagaaacttcctgctccccctgcgccatcacaagccgataagacgcctgaagtg
aaagagcaggttacaaaacctaaagagaaggaagatgtgaagaagagcagtaaaaaggag
agcgagcctgcccccagacccgccgctgggtcccggacggagaccagggtcaagatgtcg
cgtatgcgcctccgtatcgccgagcgtctcaaggagtcccagaacgccgctgcctcgtta
accaccttcaacgaaatcgacatgtcctcgctcatggagatgcgcaagaagtacaaggac
caggtcctcaaggagcatgacgtcaagctcggattcatgtctgcctttgccaaggcctgc
tctctcgccctccgggatatccctgccgccaacgccagcatcgaaggcgacgagatcgtc
taccgcgactacgtcgatttgagcgttgctgttgccacccccaagggtttggtcactccc
gtcttgcgaaacgcagagtcaatgaacttcattgagattgagagggagattgctgctctt
ggcaagaaggctcgtgatggcaaactcacccttgaggatatggccggcggtaccttcacc
atctcgaacggcggtgtcttcggatcgctcttcggaacccctatcatcaacttgcctcag
gctgctgtgctcggtatgcacgccatcaaggataagcccgtggtcgtcgacggccagatc
gtcatccgacccatcatggttgttgcccttacctacgaccaccgactgctcgacggcagg
gaaggtgttactttcctcgtgaaagtcaaggagtacattgaagatcctagaaagatgttg
cttgcttaa

DBGET integrated database retrieval system