KEGG   Coprinopsis cinerea: CC1G_08016Help
Entry
CC1G_08016        CDS       T01275                                 

Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
cci  Coprinopsis cinerea
Brite
Enzymes [BR:cci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CC1G_08016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 585 aa AA seqDB search
MAPKRSGVFLQNACLQHRYIRDQDLSNVVERPERLRAVNIGLAAAIAHLEELLEDTATPN
GSATAEYSTDETDLAAALGKMKLESADGAGGSTSSKIPIVQSQATVDLLNNAAVKFIHGD
IDGDVYLGTLKKWAKESTDKIAQGGSEIPEGYSQGDLYRSIAAIQGALGTTCEAVDAVIG
ASRGEGKQEDQIHRAFVAVRPPGHHCGEDTPSGFCFVNNVAVAAAHAHLKHGINRVVIFD
IDLHHGNGTQSIVWQINEETYRQKLEQEAGAPNVKPGAQVFYGSIHDILSYPCEDGKPEL
VQAASVSLHHAHGQFIENIHLQTYTSEEHFWSELYAKRYIQVIRKAEEFLDATGGPGDDV
MVFISCGMDACEHEYESMSRHNRKVPTGYYYQFARDTSVLSDKYAKGRLVSVLEGGYSDR
ALISGAMAHLAGLTDLPEGKQVDKAIWDLGNLVELEKATKKRRGGRPSLPAPGSTRQWIE
RTLSILAPLDTSAASILSSARSAPPMSMTLRDRSKAKSATSTPTRGVSPAPASAKQKPKG
RKSVGTPSTEKPPVGSSTSSSDDDGSGATQDKVKVKRVILKLSQS
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctaaacgatcaggcgtcttcttgcagaacgcctgccttcaacaccgctacata
cgggatcaggacctctcgaatgtcgtagaacgccctgaacgacttcgagctgtcaacatt
ggactggccgcagcgatagctcacctcgaggaactcctggaggacaccgcaacgcccaat
ggttctgccacagctgaatattccaccgacgaaaccgatctcgctgctgctctgggaaag
atgaagttggaatcggcggatggtgcgggcgggtcgacgtcctcaaagatacccatcgtc
caaagtcaagccacagtcgatttgttgaacaacgcggcggtcaagttcattcatggcgat
attgacggcgatgtctacctcgggactctgaagaagtgggcgaaggagagtacggataag
atcgcacagggtggatcagagattccggaggggtattctcaaggggatttgtaccggtcg
atagcggctattcagggtgccctcggaacgacttgtgaagctgttgatgctgttattggt
gcatcgagaggcgagggaaagcaagaggaccagattcaccgggcgtttgttgctgttcga
ccacccggacaccattgcggagaagatacaccttccgggttctgctttgttaacaacgtc
gctgttgctgctgcacatgcccatttgaagcatgggattaatcgggttgtcatattcgac
atagatcttcatcacggaaatggaactcagtcaattgtatggcaaatcaacgaggagacg
tatcgacagaagctcgagcaagaagcgggagcgcccaatgtgaagccgggagctcaggtc
ttctatggatctatccacgacattctctcctatccctgcgaggacggcaaacccgagctt
gtccaggcagcctctgtatccctgcaccacgcccacggacagttcatcgaaaatattcat
cttcaaacttacacctcggaggaacacttctggtctgaactctacgccaaacgatatatc
caagtcattcgtaaagcagaagagttcctcgacgcgactggtggtccaggcgatgacgtc
atggtgttcatcagttgcggcatggatgcttgtgagcacgagtacgagtcgatgtcgagg
cataaccgtaaggttcccaccgggtattactatcagtttgctcgggacactagtgtcctg
agtgataaatatgccaaaggccgtctagtgagcgttcttgaagggggatatagcgatcgg
gctttgattagtggtgcgatggcgcatctggctggtcttaccgatctcccggaagggaag
caggtcgataaggctatctgggaccttggaaatctcgttgagctcgagaaagcgaccaag
aaacggagaggtggaaggccttcgctgcctgccccaggatctacacgacagtggattgaa
cgcacgctctctatccttgcaccccttgacaccagtgctgccagcatcctctcttctgct
cgctcagctcctccaatgtccatgactcttagagatcggtcgaaggccaagtctgcgact
tcaacgccaacccggggcgtgtccccagctccagcttccgccaagcagaagccgaaagga
aggaagagtgttgggactccatcgacagagaaacctccagtggggagttcaacgtccagc
tctgacgatgatgggtcgggggcgacgcaggacaaagttaaagtgaagagggttattttg
aagctttcacagtcataa

DBGET integrated database retrieval system