KEGG   Coprinopsis cinerea: CC1G_08194Help
Entry
CC1G_08194        CDS       T01275                                 

Definition
calcium-dependent protein serine/threonine phosphatase
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cci  Coprinopsis cinerea
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 175 aa AA seqDB search
MGQSPSQFMEDMEKRSNFTQAELERLKKRFMKLDSDGSGSIDRDEFLSIPQIATNPLASR
MIAIFDEDGGGTVDFQEFVGGLSAFSSRGGREEKLKFAFKVYDVDRDGYISNGELFLVLK
MMVGNNLKDQQLQQIVDKTIMEADLDGDGKLSFEEFAQTVSNTDIVKQMTLEDLF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaatcaccgtcacagtttatggaggacatggagaagaggtccaacttcacgcag
gcagagttggaacggttgaagaagcggttcatgaaactcgacagcgacggctcaggatcc
atcgaccgagacgagttcctctcaataccccagatcgcgactaacccgctggcctcacgg
atgatcgcgatcttcgatgaagatggtggaggcacagtcgatttccaagaattcgttggc
ggtttgagcgctttcagtagccggggtggaagggaggagaaacttaaattcgcattcaaa
gtctatgacgtcgaccgggacggctacatctccaacggcgagctcttcctcgtcctcaag
atgatggtcggcaacaacctcaaagaccaacaactacagcaaatcgtggacaagacgatt
atggaagcggatttggacggggatggaaagttgagttttgaagagtttgcgcagactgtt
tcgaatacggatatcgtcaagcaaatgacgctcgaggatttgttctga

DBGET integrated database retrieval system