KEGG   Coprinopsis cinerea: CC1G_08308Help
Entry
CC1G_08308        CDS       T01275                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cci  Coprinopsis cinerea
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CC1G_08308
Enzymes [BR:cci01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     CC1G_08308
Glycosyltransferases [BR:cci01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   CC1G_08308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 758 aa AA seqDB search
MGEDDGLGGLGGGVGYGEKETLFSYDDDEGKDVYSKPRPVQSRIASGRLPAPPLPPPTSF
KEFLWQNAEHIPPIIYTLLSCWTRYHKIGASNIVVWDEAHFGKFGSHYLKREFYFDVHPP
LGKMLVGLAGLLAGYNGGFEFKSGETYPETVPYVAMRVMLATFGVLMVPLAWYTSLELGM
SLWASHLTTLMVLLDVGWLVISRFILLDSMLLFFTFLTVFCLTRFHNEQYDPFSIDWWAW
LLFTGISIGCVTSVKMIGLFVTALVGIYTIEDLWDKFGDTRLTVREQAKHWGARILCLIV
VPILVFMASFKAHFMVLNRSGPGDAQMSSLFQANLVGNDFYKNPLEIAYGSKVTLKNMGW
GGGLLHSHVQTYPVGSNQQQVTCYHYKDNNNDWVILPRWEESKFDPVEGELRYLKHGDIV
RLNHAPTTRNLHSHTVTAPVTKLNYEVSCYGNSTVGDRHDYWQVEVVDDIKRGKLGPGER
IHSLTTRLRFRHKVLGCYLRAANAVLPQWGFKQIEVSCDKENNPRDAHTHWNVESHWNER
LPAGNMKLYKSPFLRDFWHLNVAMMTSNNALIPDPDKEDILASKPFDWPLLHLGLRMCGW
GDNQLKFYLLGTPVIWWASTISLVVGLMTFGVYMLRWQRKYVDMDQREWDHFMYVGKIAF
FGWVFHYVPFLIMGRVTYLHHYLPTLYFAVLMLSHVLDHFIFSSRRFSTKTKSIVFGVIA
GIIVFTFWWFKGVAFGIQGPINEHWGLQWRKTWNIYNN
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaggatgatgggttgggtgggttaggtggtggtgttgggtatggggagaaggag
acgttgttctcgtatgatgatgatgaagggaaggatgtgtatagcaaaccgcgccctgtg
cagagtcggatagcgagtgggaggcttccagcgccgcctcttcctcctcctacctccttc
aaagaattcctctggcaaaacgccgaacacatcccaccgatcatctacacactcctctcc
tgctggacacgctaccacaaaatcggcgcctccaatatcgtcgtctgggacgaagcccat
ttcggcaaattcgggtcgcattacctcaagcgcgagttttactttgatgtgcacccgccg
ttgggcaagatgttggttggcctggcgggactgttggcggggtataatggcggtttcgag
tttaagagtggggagacgtaccccgagactgtgccgtatgttgcgatgagggttatgctt
gcgacgtttggggtgttgatggtcccccttgcttggtatacctcgttggagttgggtatg
agtttgtgggctagtcatttgactacgcttatggttttgcttgatgtcggctggctggtt
atctctcgtttcattctcttggattcgatgttgctcttcttcacgttccttactgttttc
tgtttaactcggttccataacgagcagtatgacccgttctccattgattggtgggcgtgg
ttgctctttactggtatttctatcggttgcgttacgagcgtcaagatgattggcctgttc
gttaccgctcttgttggtatctacactattgaagacctctgggacaaattcggcgatacg
cgactcacagtcagagagcaagccaaacactggggagctcggattctctgcttgatcgtc
gtccccatcctcgtcttcatggcctcgttcaaggctcactttatggttctcaaccgctct
ggaccaggtgatgcccagatgagctcgctcttccaggctaaccttgtcggtaacgatttc
tacaagaatcctctcgaaatcgcgtacggctccaaagtgaccttgaagaacatgggttgg
ggcggtggcctccttcactcgcacgtccaaacctacccggtcgggtcgaaccaacaacaa
gtcacctgctaccactacaaggacaacaacaacgattgggtcatcctgcctcgttgggag
gaatccaaattcgaccccgtcgaaggcgaacttcggtacctcaagcacggtgatatcgtc
cgcctcaaccacgcgcctacgacccgcaacctgcactcgcacaccgtcactgcgcccgtc
acgaaactcaactacgaagtttcgtgttacggcaacagcactgtcggtgatcgtcatgat
tattggcaagttgaggtcgttgatgatattaagagggggaagcttggacctggggagagg
attcattcgttgacgacgaggttgaggtttaggcataaggtgcttgggtgttatttgaga
gctgcgaatgctgttttgccgcagtgggggttcaagcagattgaggttagttgtgataag
gagaataatccgagggatgcgcatacgcattggaatgtggagagtcattggaatgagagg
ctcccagccggcaacatgaaactctacaaatcccccttcctacgcgacttttggcatttg
aacgtggcgatgatgacgtccaacaatgctttgatccccgaccctgacaaggaggatatc
ctcgcttccaaaccgtttgattggcctttgttgcatttgggcttgaggatgtgtgggtgg
ggtgataatcagttgaagttttatttgcttggtacccccgtgatctggtgggcgagtaca
atcagtcttgtggttgggttgatgacatttggcgtgtacatgttgaggtggcagcgcaag
tatgtggatatggatcagagggagtgggatcattttatgtatgtgggcaagattgcgttt
tttggatgggttttccattatgtcccgttcttgatcatgggtcgcgttacctatctgcat
cactacctcccaaccctctactttgccgtcctcatgctctcccacgtcctggaccacttc
attttcagctcgcgccgtttctcgaccaagactaaatcgattgtgtttggtgttattgcg
ggtatcatcgtgtttacgttttggtggttcaagggtgttgcgtttgggatccagggtccg
attaatgagcattgggggttgcagtggcggaagacgtggaatatctataacaactaa

DBGET integrated database retrieval system