KEGG   Coprinopsis cinerea: CC1G_08568Help
Entry
CC1G_08568        CDS       T01275                                 

Definition
(RefSeq) alpha amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
cci  Coprinopsis cinerea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CC1G_08568
Enzymes [BR:cci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CC1G_08568
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 675 aa AA seqDB search
MFSPKLEVEVSLINHSYDNDVLSGTINVQNIAYSKVVVVHWASGDTWSDSQTIAATYSSS
GSNNFETWSFSGRAPGATQFYIRYVVSGQTYYDPGNYQNHQISRPPGGGNPSPPGPAPTG
PANLPAILPSNVPYEAPANPPSGCSNFNGWDNCNGGNTEMVASSERRRWQTPPRGDPAYF
ESFQDYSHLVGYANIQYNSGRTSAVVTVNAVHKEGAELTYSFNGVEQSSPSFEVDSSLQG
TLAITVTSSDGKKLVLEPLNFFWQHQSLSAAQSNFNNGQKGGIVELFGWPWKDIEKECEF
LGKAGYMGVKVWPPTEHVWGSHHYEPDTQFRPWYQVGRNATDYSPYYTNGNTYLINPFTG
TRPTLEFPAVPFGPTDFHCERGIDDWNNGFLITRGWLVGLTDLNTAKPYVQDRIATFLVD
LISIGFSGFRVDAAKHIGPNEMAQILGRVKNKLGGSLPADFLTWMEVIIGGETQLNACGG
GEYSWYTNFDNRLRANGFGNDDIQKVKIWSSDYPASMPICGHWILPPSRFAVQNDDHDQQ
HEGSSPRWMGDKGSVLIKDKNVGAHRHFSVNLFSRRDHDWHIKLLLSSYMFSHEGGNGFP
DGLSDCNTHYTGTLPRSGCRGIGFDQAYVANACGYTMVPGKYTRPHRDISIINAMRGWVG
LPPTNAHDLGIPGCH
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgttttctccaaagttagaggttgaggtctctttgatcaaccactcgtatgacaacgat
gttctctctgggaccatcaatgtccaaaacatcgcgtactccaaggtagtcgttgtccat
tgggcgtctggcgacacctggagcgactctcaaaccatagctgctacctactcttcctcc
ggttctaacaacttcgaaacttggtctttctctggtcgggctcctggcgctactcaattc
tacatccgttacgtcgtctccggtcagacctactacgaccccggcaactaccagaaccac
cagatctctcgtcctcccggaggtggcaaccctagcccgcccggccctgcgccgactggg
cctgccaacctccccgctatccttccctccaacgtaccttatgaagcgcctgccaacccc
ccttcgggatgcagcaacttcaatggttgggataactgcaacggtggaaacaccgagatg
gttgcctcctccgaacgtcgccgctggcaaacccctcctcgtggcgatcccgcctacttc
gagtccttccaggactacagccacctcgtcggatatgccaacattcagtacaattctggc
cgcaccagcgcagtcgtcaccgtcaacgctgtgcacaaggagggcgctgagctcacctac
agcttcaatggcgtcgagcaatcgtcccccagcttcgaagtcgatagcagccttcaagga
actctggccattactgtcaccagctcagatggcaagaagcttgttctcgagcctctcaac
ttcttctggcagcaccagtctctgtcggccgcacagagcaacttcaacaacggccagaag
ggtggtatcgtcgagttgttcggctggccctggaaggatattgagaaggagtgcgagttc
cttggcaaggctggatacatgggtgtcaaggtttggcctcctaccgagcacgtctggggc
tcccaccactacgagcccgacacccaattccgcccttggtatcaggtcggccgcaacgcg
actgactactccccctattacaccaatggcaacacctacctcatcaaccccttcaccggt
acccgccctaccctcgagttccccgccgtccctttcggccctaccgacttccactgcgag
cgcggcatcgacgactggaacaacggcttcctcatcacccgcggctggctcgtcggcctc
accgacctcaacaccgccaagccctacgtccaggaccgaattgcgaccttcctcgtcgac
ctcatctccatcggtttctctgggttccgggtcgacgctgccaagcacattggtcccaac
gagatggctcagattctcgggcgagtgaagaacaaattgggcggatcgttgccggctgac
ttcctcacctggatggaagttatcatcggtggtgaaacgcagctgaatgcctgtggtggt
ggagagtacagctggtacaccaacttcgacaatagactgcgggccaatggcttcggcaac
gacgatatccagaaggtcaagatttggagctctgactaccccgctagcatgcctatctgc
ggccactggatcctccccccttcccgcttcgccgtccagaacgatgatcacgaccaacag
cacgagggctcctcaccccgctggatgggcgacaagggatccgttctcatcaaggataag
aacgtcggcgcccaccgccacttctccgttaacctcttctcccgccgcgaccacgactgg
cacatcaagctcctcctgtcttcctacatgttcagccacgaaggcggaaacggcttcccc
gacggcctgagcgactgcaacacccactacaccggtaccctcccccgctccggctgcagg
ggtatcggcttcgaccaggcatacgtcgccaatgcctgcggttacaccatggtccccggc
aaatataccagaccccaccgtgacatcagcatcatcaacgcgatgagaggatgggtcgga
cttccccctaccaatgctcacgacctgggcattcctggctgccattag

DBGET integrated database retrieval system