KEGG   Coprinopsis cinerea: CC1G_08613Help
Entry
CC1G_08613        CDS       T01275                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cci  Coprinopsis cinerea
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CC1G_08613
Enzymes [BR:cci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CC1G_08613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 353 aa AA seqDB search
MTPNRPFGTSKCAVRGSIMDQIAKPGETKASKLHESRIGGKGANQAVAIARAGGLVQFYG
TIGKDGVWIKEQLKEHGIDKPTGRAIIQVGDDGENSIILFPGANHSELHEQQKFSSGRPW
FGNATHLLLQNEIHPRSTLHALHEAANMVTIFNPSPMPPADQIREFPWTKIDWLLVNEGE
AEALLRILGPPPPLNIRPASISAMSTKDIVFCLASHPSFASTNIICTLGPDGVLAFVPEF
HRPGTKHEAPSFMHLPPAKLEGDFRDTTGAGDCFTGYFVQGLMEFGPDARPGHHITERDL
AMLLRKCNLAAGMSVEKPGTIDSIPSRAAVESRLAASYAGSPIITGMKGPSGV
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgactccgaacaggccttttggcacatccaagtgcgctgtacgcggttctattatggat
caaatcgccaagcctggtgagaccaaggcgtcgaagctgcacgaaagcaggattggtggg
aaaggcgctaatcaggctgttgcgattgcgagggctggtggtttagtccagttttacggt
acgattgggaaggacggggtttggatcaaagaacagctgaaagagcatggtatcgataaa
ccgacaggaagagccatcatccaggttggtgatgacggagagaacagtatcattttattc
cccggtgcgaaccacagcgagctacacgagcaacagaaattctcgtccggtcgaccatgg
ttcggcaacgcaacacacctcctgctgcagaacgagatccatccgcgctcgactctgcat
gcactgcacgaggcagccaacatggtgaccatcttcaacccgtctccaatgccaccggcg
gaccagatccgcgagtttccgtggaccaagatagattggcttttggtgaacgaaggggag
gctgaggcgcttcttcgcatcctcggacctcccccgccgcttaacatccgaccagcctct
atcagcgctatgtcaaccaaggatatcgtcttttgtctcgccagccacccgtcctttgcg
agtacgaatatcatttgtacgttgggacccgatggcgttttggcgttcgtccccgagttc
catcgaccggggacgaaacatgaagcgccgtcgttcatgcatctcccgcctgccaaattg
gaaggggacttcagggatacgaccggtgcgggagattgctttacgggatactttgtacag
gggctcatggaattcggaccggatgcgagacctggacaccacattacggagagggatctg
gcgatgttgttgaggaagtgtaatttggctgctggaatgtcggtggagaaaccggggact
attgatagcatcccctctcgagctgctgtcgagtctaggctggctgcatcgtatgccggg
agcccgattattacaggaatgaaggggccttcgggggtttag

DBGET integrated database retrieval system