KEGG   Coprinopsis cinerea: CC1G_08731Help
Entry
CC1G_08731        CDS       T01275                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cci  Coprinopsis cinerea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CC1G_08731
Enzymes [BR:cci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CC1G_08731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 292 aa AA seqDB search
MPNVLLFRDPVPGPSTDPYEDLFHQQNLGYTTKCVPVLETTHANIDELASRLVKGYEKYS
GMVITSKRSCEAVHEALSNLSSDDNHIINNNRESLSKALAHWSSVPFYVVGEGTSTAIHT
VQRAFHHLGFTKIQTKGEASGTGEQLGHFIVKEHGQDAKEPLLYLTGDKNRDTVPTLLTK
GNIKFESLRVYETTGRKDFERLLEDAVTSFQDANQPWWITYFAPSSASFVFPLVQTHPAL
RNARIAAIGPVTSTHLEKQMGVSPQVVATNPKPEDLVSAIVEYDGAHPYTDE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacgtcctcttattccgcgacccagttccaggtccttcaaccgacccatacgaa
gatctcttccatcaacagaaccttggatatacaaccaaatgcgtcccagtactcgaaact
acgcatgccaacatcgacgagttggcgtctcgcctcgtcaaggggtacgagaagtacagc
ggcatggtgatcacgtccaaacgatcctgcgaggccgtgcatgaagctctctcaaacctc
tctagcgacgataaccacatcatcaacaacaacagagagtcgttgtccaaagcactagca
cactggtcctccgtaccattctacgtcgtaggcgaaggaacctccaccgccatccacacc
gtccaacgcgcattccaccacctcggtttcaccaaaatccaaacgaaaggcgaagcttca
gggacgggcgagcaactggggcactttatcgtcaaagaacacggccaagacgcgaaggag
ccgttgttgtatctgactggggacaagaatcgggataccgttcctacgcttttgaccaag
ggtaatatcaagtttgagagtctgcgggtgtacgagacgacaggaaggaaagatttcgag
aggttattggaggacgctgttacgtcttttcaggatgccaaccaaccctggtggataacc
tacttcgccccctcgagcgcgagcttcgttttcccactcgtccaaacacatcctgcgctc
cggaatgcacggatagcagccatcggaccggtcacctcgacgcacctggagaagcaaatg
ggcgtatcaccgcaggtcgtagcgactaacccaaaaccagaagatctggtctctgcgatc
gtcgagtatgacggagcccatccgtacaccgacgagtaa

DBGET integrated database retrieval system