KEGG   Coprinopsis cinerea: CC1G_08832Help
Entry
CC1G_08832        CDS       T01275                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
cci  Coprinopsis cinerea
Brite
Enzymes [BR:cci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CC1G_08832
Peptidases [BR:cci01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CC1G_08832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 660 aa AA seqDB search
MGIESYLPWMWSSSSAASGSTGSTGKSGSREKKKDRKAIRTRAEQIQLNGNAKQHGSGKE
EEDEGYYPGLVNVSGTYCFMNSTLQALASLSYLQPHIDAIHAKAEALDVPTPVIDALKEL
FQDLNTPKSAYRAIRPMDIINVLSQQTEGRTNSLFYSREHQDAQELFQVVSECIKNELAA
VDKEGLRDRGFGSALDKPSETTKEIGKSVFDGLTANRRSCVVCGYTEAVMHFAFDNWQLS
VPRMAGSCRLEDCLEDYTRLEILKDCICRKCSLVATHNRLKQELATLEEATKPGTNPSSS
KKRRLKEVRKFEARVRAALAEGRIEEDLKDVRIEKVFSPASTKQAMIARPPPVLALHLNR
SIHYGHYAGKNNCRVAFPEVLDLTPFTTSGSLSTIPTASISTPPPAVPRSTTPTPSTYSN
QRTIYRLAAVVCHFGGHSFGHYICYRRKPRPTGLPKEKRFAPPVLVDPLRIPDGDVDDEN
QAQSQGPEYIFEDGETQPGKGWLRISDDSVRECGIESVLAEGAGVFMLYYERAVPPRPGI
YPSQSGTRVSEETLRPEMKTVELNGSVGSFGGFFAIVFVGEGQGEGDTGRERFKHWPCVV
TVDIVGGTKGDQKCGGWEGEEYEYTTVVLRGLATSIELSTIRIDAEIASEWKCNPLGRVK
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcgagagctacctcccctggatgtggtcctcgtcgtcggcggcgtcaggaagc
actgggagtactggcaagtccggaagcagagagaagaagaaggacaggaaggccattcga
acgagagcggagcagatccagctgaacggcaatgcgaaacaacatggctccgggaaggaa
gaagaggacgaaggatactaccctgggttggtcaacgtctcggggacgtattgtttcatg
aactcgacgctccaggctttggcttcgctttcctatctccaaccgcacatagacgccatt
cacgcaaaggcagaagccctcgacgttccgacgccagtaatcgacgctctcaaggagcta
ttccaagacttgaacacacccaagtcggcttaccgcgcaatccgcccaatggacataatc
aacgtgctcagtcaacaaactgaaggccggacgaactccctcttctactcgcgagagcac
caagacgctcaagagctcttccaagtggtttcggaatgcatcaagaacgagttggcggca
gtggataaagaagggttaagggatcgcggctttggaagtgcacttgacaaaccttcggag
acgacaaaggagattggcaagagcgttttcgatgggttgaccgcgaaccgaaggagttgt
gtcgtttgcgggtataccgaggcggttatgcatttcgcattcgataactggcagttatct
gttccaaggatggcaggtagctgcaggttggaagactgcctcgaagactacacccgactt
gaaatcctcaaggattgcatctgtagaaagtgctcactggtcgcgacgcataaccggcta
aagcaggaactcgccacgttggaggaagcgacgaaacccggcacaaatccttctagctcc
aagaagagacgattgaaggaagtgaggaagtttgaggctcgtgttcgggcagcgttggca
gagggtcggatagaagaagacttgaaagacgtgaggatagagaaagttttcagcccggcg
tctaccaaacaagctatgattgcccgacctcctccagtactcgctcttcatctgaaccgt
tccatccattacggacattatgctgggaaaaacaactgcagagttgctttccccgaggtc
ctcgatttgacaccttttacgacctccggatccctttccaccatcccaacagcatctatc
tcaacaccgcctccagcagttccccgctcaacgacgccaacaccctccacttactccaac
caacggacaatctatcgtctcgcagcagtggtctgtcatttcggtggacactcctttggt
cactatatctgctatcgacggaaacctcggccaacgggattgccaaaggagaaacgcttt
gcaccgcctgtccttgtcgacccgctgcggataccggacggcgacgtagacgacgagaac
caggcacaaagccagggtcctgaatacatcttcgaagatggggaaacgcaaccggggaag
gggtggctgcgaattagcgatgactctgtgcgagaatgcgggattgagagtgtgttggcc
gagggcgcgggggtatttatgctctactacgagcgggctgttccaccacggccgggtatc
tacccttcgcaatccggaacgagggtgtcggaggagacgttgagaccggagatgaagacg
gtggagctgaacgggagcgttgggtccttcggtggcttcttcgccatcgtcttcgtgggt
gaagggcaaggagagggagatactgggcgggagaggttcaagcattggccttgcgtcgtc
actgtcgacatcgtgggtggaaccaagggtgatcagaagtgtggcggctgggagggggag
gagtacgagtacacaaccgtcgtcctccgtgggctcgctacctctatcgagctctctacc
atccgaatcgacgctgaaatcgcatccgaatggaaatgcaacccactcggaagagtcaaa
tga

DBGET integrated database retrieval system