KEGG   Coprinopsis cinerea: CC1G_09006Help
Entry
CC1G_09006        CDS       T01275                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cci  Coprinopsis cinerea
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CC1G_09006
Enzymes [BR:cci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CC1G_09006
Exosome [BR:cci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CC1G_09006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 541 aa AA seqDB search
MTTTTGKPPLKQGEFVGALDCGTTSIRFIVFNKHADIIAQHQEEFPQYYPQPGWHEHDAN
EIQQTSDLCIEEAVKKLEETGWSKDSIKVIGITNQRETAVAWSRRTGKPLCKAIVWTDSR
TKGTVAHHMNKLQTVGIQTSPGVFRKGQDGVDALREITGLPLSTYFSAIKVRWMIDHLPE
VQKAHEEDDLAFGTVESWVAYNLLGGLEKNIHISEVTNASRTLLLNTSTLKWEPSLLEFF
GLRPSILPRLVSTSEVYGNVAYGPLKGVPIGGLVGDQQGALIGNKCLTQGEAKCTYGTGA
FLLFCTGDSIVQSNHGLLSTVAYQAGPEAKPVYALEGSIAVAGSAIKWLRDSMSLVSSAS
EVNTLAAREPDTGGVYFVTAFSGLLAPYWDPGAGGMLIGISQYTNPSHIARATLEANAFQ
TRAIIESMKLDSGTDLKNMKVDGGMTNGDLAMEVLADIGGFTVVRPQMRESTALGAAICA
GSAMKLFGWDLSKPETLNGVNDRANTVFEPWLDDATRAKKWHGWQRAVERSRGWDEGTEE
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgacgacgggcaaaccccccttgaaacagggagagttcgtaggggctttggac
tgcggcacaacgtctatccggttcatcgtcttcaacaaacacgcggacatcattgcccag
caccaagaggagtttcctcaatattaccctcagcctggatggcatgaacacgacgcaaat
gaaatccagcagacttcggatctatgtattgaggaggcggtgaagaagctcgaagagact
gggtggtccaaagatagcatcaaagttatcggtataactaaccaacgagagaccgccgtt
gcatggagccgacgaacaggcaaacctctctgcaaagctattgtgtggacggactcgcgt
acgaagggaactgtcgcgcaccacatgaacaagctacaaactgtcggcattcagacttcc
cccggtgtgttcaggaagggccaagacggtgttgacgcattgagggagatcaccggatta
ccgctctcgacgtacttttcggccattaaggtcagatggatgatagaccatcttccggaa
gtgcagaaagcacatgaagaggatgatttggcgttcggcacggtcgagtcttgggtggcc
tataacctcctcggcggactggaaaagaacatccacatcagcgaagtgaccaacgcctcg
cgaactctccttctcaacacttctactctgaaatgggaaccctccctccttgagttcttt
ggacttcgcccttcaattttacccaggcttgtgtccacttccgaagtgtacggaaatgtt
gcgtatggtccgctcaagggtgtgcccattggagggttggtgggtgaccagcagggtgcc
ttgattgggaacaagtgtctcacccagggtgaggccaagtgcacgtacggaacgggagcg
ttcttgttgttctgcaccggcgattccattgtgcagagcaaccatggcttgttgagtacc
gttgcgtaccaggctgggcccgaggcgaagcccgtttacgctttagaaggatcaatcgcc
gtcgctggaagcgccatcaagtggctgcgcgactcaatgtcgctcgtctcgtctgcaagc
gaggtcaacacccttgctgctcgagagccagataccggaggcgtgtactttgttacagcc
ttctctggtctgctggctccttattgggacccgggtgcaggtggcatgctcattggcatc
tcgcaatacacaaacccctcgcacatcgcgcgcgccacgttagaagcgaacgcgttccag
accagggctatcatcgaaagtatgaaactcgactctggcactgatctgaagaacatgaag
gtcgatggagggatgacgaacggcgaccttgccatggaggttttggctgatatcggagga
ttcactgtcgtcagacctcagatgcgagagtcaacggctctcggtgcagctatttgcgct
ggttccgccatgaagctcttcggatgggatctgtccaaacccgagaccctgaatggtgtc
aatgaccgcgctaatacagtttttgaaccctggttggacgatgctactcgggctaagaag
tggcatggatggcagcgggctgttgagcgatctagaggatgggacgagggtacagaagag
aaatga

DBGET integrated database retrieval system