KEGG   Coprinopsis cinerea: CC1G_09463Help
Entry
CC1G_09463        CDS       T01275                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase 1
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cci  Coprinopsis cinerea
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CC1G_09463
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    CC1G_09463
Enzymes [BR:cci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CC1G_09463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 881 aa AA seqDB search
MDKRPRNARSEMYLLRQQETIVLCYFHLTLFHLCLTLAKHRKAKEFARMSAEILKSEAPK
DTSGVPHPTDDASPFSIPDIVLNGTEMTKISKKGKKRVVFRIDPDEGRLLYKSKKGGLVP
IEAIKEMRSGEDARYYCNQFEQPEEAESRWITVIYILGGAYKTLHILADTRDAFHAWDTT
LRKLHSVRQGLTTGLGNMETREEVWERQYWKGADEEGDQVLDFDDVDRLCKRLHANIPTP
RLQQLFKEADTENKGHLDYPAFQRFVKKLKRRPDVEQIYGQIAGQSGGKFDFAAFEKFIK
EVQKSPLSTDELRAVFDKYATSADSTSPNEPSGALTLDAFTKFLTSPDNAAFAEEGKPIW
QDMTKPISEYFISSSHNTYLVGNQLTGVSTIEGYIRALLHSCRSVELDIYDGDDEPVIFH
GKTLTSKVPLRDVCVAIMKYGFTTSPYPLLVSAEVHCGLAQQEKMVDVMTEVWGDALIQA
PVNGRPQLTHLPSPEDLKHKILLKAKNLYVVEQLAKAKAKRAEEKAAVLEADPSSESTNE
STDDDAGESKPGALGALKSRWRKMRGKDPKPAKPKVKMSFRLASLLVYTIGVKCHGLNDE
VQYAPEHIFSLSEYSANKLLKVGMWDLIRHTQGHLVRIYPKGTRVNSTNFEPHRYWASGA
QVVAINWQTFDLGYVMNQAMFQRNGRSGYILKPEALRSLDKDLFSKRTKHFLDITIISAQ
QLPPLRDSKGNEVFGKSIPDPFVEVSLLIPDWTNSPFLPESAKAEGAEYHSPSEGNTTTA
TSARTVKMKTQVVTDNGFNPTWNEQLHLPFDCVGGMMDLIFVNVAVRQEGKEDEDDEPLA
MYCIPLGSLNQGYRHLPLHDAQMNQHLFSTLFVNVAIRDAD
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atggataaacgtcctcgaaacgcaaggtctgagatgtatctgttgcgccaacaggagacg
atcgtgttgtgctactttcatctcaccctgtttcatctttgcctgacactggcaaaacat
cggaaagccaaagagttcgccagaatgagtgcagaaatcctcaagtcggaggcgccgaaa
gacacgtcgggtgttccccatcccaccgacgatgcttcgccattctcgatccccgatatc
gtcttgaacggcactgaaatgaccaagatctcgaagaaggggaagaaacgagtcgtgttc
cggatcgaccctgacgagggacgcctcctttacaagtcgaagaagggcgggctggtaccg
atcgaggccatcaaggagatgcgctctggcgaagatgcacgatactattgcaaccagttc
gagcagccggaggaagcggagagtcgatggatcaccgtcatctacatcctcggcggcgcc
tataagaccctccacatcctcgcagacacgcgtgacgccttccatgcctgggataccact
ctacgcaagttgcactcggtccgacagggcctcaccaccgggctggggaatatggaaacg
cgagaggaggtctgggagagacagtattggaaaggggctgatgaggaaggcgaccaggtc
ctcgactttgatgatgtcgaccgtctctgcaagcgactccacgcgaatatccctacccct
cggcttcagcagctgttcaaggaagctgacacggagaacaaaggccatcttgactacccc
gcgttccaacgattcgtcaagaagctcaagcgtcgacctgatgtcgaacagatttacggt
cagatcgcagggcagagcggcggtaaattcgattttgctgccttcgagaagttcatcaag
gaggtccagaagtccccgctttcaaccgacgagcttcgggcagtcttcgacaaatatgct
acatcagcggattcgacatctcccaacgagccttcgggtgccctgaccttggacgcattc
accaaattcctaacctccccagacaatgccgccttcgccgaggagggcaagcccatctgg
caagacatgaccaagcccatctccgaatacttcatctcatcctctcacaacacctacctc
gtcggtaatcagctcacaggagtcagtaccatcgaaggatacatccgagccttgcttcac
agctgccgcagcgtcgagttggacatctacgacggcgatgacgaacccgtcattttccac
ggcaagactctgacctccaaggtcccgttgcgcgatgtctgcgtcgcgatcatgaagtac
gggttcacgacttcgccctatcctctactggtgtccgccgaagtccattgcggcctcgct
cagcaagagaagatggtggatgtcatgacggaggtctggggcgacgccttgatccaggct
ccggtcaacggtcgaccacagctcacccacctgcccagccctgaggatctcaaacacaag
atccttctcaaggccaagaacctctacgtcgtcgagcagctggccaaggccaaagcgaag
agggcagaagagaaggccgccgtcctcgaagccgatccctcctcagagtctacgaacgaa
tccaccgacgacgacgctggcgagtccaagcccggtgctctgggcgcgctcaagtctagg
tggcgcaagatgcggggcaaggatcccaagcccgccaagcccaaggtcaagatgtccttc
cgcctcgcctcgctcttggtgtacaccatcggcgtcaagtgtcatggtctcaacgatgaa
gtccagtatgccccggagcacatcttctcgctctcagagtactcggcgaacaagctgttg
aaggtggggatgtgggatttgattaggcatacgcaggggcatctggttcggatttacccc
aagggtacgcgggtgaactcgacgaattttgagccccatcggtactgggctagtggggcg
caggttgtggctattaattggcagacgtttgatctgggatatgtgatgaaccaggcgatg
ttccagaggaatggtcgctctgggtacatcctcaagcctgaagctctccgttcgctcgac
aaggacctcttctccaagcgaaccaagcactttttggatatcacaattatctccgcccaa
cagctccctcccctccgtgactccaaagggaacgaagtattcggcaaatcaattccagac
cccttcgtcgaagtctcgctcctaatccctgactggacgaactctcccttcctcccggag
agcgccaaagccgagggtgccgagtaccactccccgagcgaggggaacacgacgacggcg
acgtcggcgcggacggtgaagatgaagacgcaggtagtgactgataatgggttcaatccc
acgtggaatgagcagttgcatttgccgtttgattgtgtgggtgggatgatggatttgatt
tttgtgaatgttgcggttaggcaggaggggaaggaggatgaggatgatgagccgttggcg
atgtattgtatcccgcttgggagcttgaatcaaggatatcgccatctccctctccacgat
gcgcagatgaatcagcatctgttctccaccctcttcgtcaatgtcgccatccgcgatgcg
gactaa

DBGET integrated database retrieval system