KEGG   Coprinopsis cinerea: CC1G_09467Help
Entry
CC1G_09467        CDS       T01275                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cci  Coprinopsis cinerea
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CC1G_09467
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CC1G_09467
   00620 Pyruvate metabolism
    CC1G_09467
   00640 Propanoate metabolism
    CC1G_09467
  Energy metabolism
   00680 Methane metabolism
    CC1G_09467
Enzymes [BR:cci01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CC1G_09467
Lipid biosynthesis proteins [BR:cci01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CC1G_09467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 661 aa AA seqDB search
MSEGPIRVAPHPIAKRVKHGCKTPHVSHIDDYRSQHRETIGHESDKWWAKKAHELLYWDR
PFHTVRSGSFENGDIAWFPEGGLNASYNCVDRWAFKHPEKTAIIYEADEPGEGREISYAE
LLREVCSIANVLKSFGVKKGDTVSVYLPMTWQAIAAFLACARIGAIHSVVFAGFSAEALR
DRMQDCKSRVLITSDEGRRGGKAIATKAIADAALKECPAVEKVLVLKRTGNPVPWTEGRD
VWWHEAVARVPRYCPPEVMASEDPLFILYTSGSTGKPKGVVHTTGGYLLCAALTVKYVFD
VHPDDRFACMADVGWITGHTYIVYGPLAIGVTTTVFESTPVYPTPSRYWETVEKYKLTQF
YSAPTAIRLLRRLGHEHVNKHDLSSLRVLGSVGEPINPEAWHWYNEHVGKTECAIVDTFW
QTETGSIVVTPFPGAIETKPGAATVPFFGIEPAILEPTTGKVLEGNDVEGVLTIAHPWPS
IARTIYGDHQRYLETYMKPYPGYFYTGDGAARDEDGYIWIKGRVDDVINVSGHRLSTAEI
ESALITHTGVAETAVIGTADELTGQAVYAFVTLKPEFKFDPENEAGLSKELILQVRKIIG
PFAAPKRIYIVSDLPKTRSGKIMRRILRKIVAGEADQLGDLSTLADPGIVEVIKEKVASA
A
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaggtccaatccgagtcgctccccaccccatcgccaagcgcgtcaagcatggc
tgcaagacgccccatgtctcccatattgacgattaccgaagccagcaccgggaaaccatt
ggccacgaatccgacaagtggtgggcaaagaaagctcatgagcttctttactgggatcga
ccattccatactgtccgctcgggcagcttcgagaatggcgacattgcttggttccctgag
ggtggtttgaacgcctcctataactgcgttgaccgctgggcgttcaaacatccggaaaag
accgcgattatctacgaagcagatgaacctggcgagggaagggagatctcttacgcggaa
ctcctacgggaagtctgcagcatcgcaaacgtgctcaagtcgttcggcgtcaagaagggc
gacaccgtctccgtctacctccccatgacctggcaagccatcgccgccttcctcgcgtgt
gcccgcatcggcgccatccactccgtcgtctttgctggcttctcggccgaagcattgcgt
gatcgtatgcaagattgcaaatcgcgtgtgctcatcacgtccgatgaagggcggcgcggt
gggaaggcgattgctaccaaggccatcgcggatgcggccctcaaggagtgcccggcggtt
gagaaggtgttggtgttgaagaggacgggtaacccggttccgtggactgagggtcgggat
gtgtggtggcacgaggcggtcgccagggtgccgaggtactgccctcccgaggtcatggca
tccgaggaccctctcttcatcctctacacttctggctcgactggcaaacccaagggtgtc
gtgcacacgactggtggatatctactctgcgccgcgttgactgtcaaatacgtcttcgat
gtccaccccgacgacaggttcgcttgcatggccgacgttggctggatcacgggccacact
tacatcgtctacggtcctctcgctattggcgttaccaccaccgtgttcgagtccactccc
gtataccccactccttcacgatactgggagaccgtcgagaagtacaagctcacccagttc
tactcggcccctaccgctatccgactcttgcgccgcctcggacacgagcacgtcaacaag
cacgatttgagcagtttgcgtgtgttgggaagcgttggagagcccatcaaccccgaggct
tggcactggtacaacgagcacgtcggaaagaccgagtgtgctatcgttgataccttctgg
caaactgagactggttccatcgtcgttactcctttccccggtgctatcgagaccaagcct
ggtgccgcgactgtgcccttcttcggtattgagcccgccatcttggagcctaccactgga
aaggtgctcgagggcaatgatgtcgagggtgttctcactatcgctcatccctggccttct
atcgctcgaaccatctacggagaccatcagcgctacctcgagacttacatgaagccttat
cccggctacttctacaccggtgatggcgctgctcgtgatgaggacggctacatctggatc
aagggtcgtgttgatgatgtcattaacgtttctggccatcgtttgtccaccgccgaaatc
gaatccgctctcatcacccacactggagttgctgagaccgccgtcatcggtaccgccgac
gaactgaccggccaggccgtctacgccttcgtcactctcaagcctgagttcaagttcgac
cccgagaacgaggctggcctctccaaggagctcatcctccaagtccgcaagatcatcggt
ccctttgctgcgcccaagcggatctatatcgtcagtgacctccccaagactcgctccggc
aagatcatgcgacgtatcctccgcaagatcgtcgctggcgaggctgaccagctcggtgac
ctcagcaccctcgccgacccgggcatcgtcgaagtcatcaaggagaaggtcgcctctgct
gcgtaa

DBGET integrated database retrieval system