KEGG   Coprinopsis cinerea: CC1G_10306Help
Entry
CC1G_10306        CDS       T01275                                 

Definition
(RefSeq) hypothetical protein
  KO
K00418  ubiquinol-cytochrome c reductase subunit 8
Organism
cci  Coprinopsis cinerea
Pathway
cci00190  Oxidative phosphorylation
cci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    CC1G_10306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UcrQ Cyt_b-c1_8
Motif
Other DBs
NCBI-GeneID: 6014445
NCBI-ProteinID: XP_001837885
UniProt: A8P0G7
Position
6
AA seq 103 aa AA seqDB search
MRPTAARFSDMPGPKVYNLWWGDKTGTLRQKGITTYTISPYQTKTAPHWARNYLFNFYRR
IGGELLFFGIPFALGYATYAWAKKHDAYMNSKAGHIAHGSHEE
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccaccgctgcacgattcagtgacatgcccggacccaaggtctacaacttgtgg
tggggtgacaagaccggcactctcaggcaaaagggcattaccacctacaccatctcgcca
taccagaccaagaccgctccccactgggcacgaaactacctcttcaacttctaccgacga
attggaggagagctcttgttctttggcattcctttcgctcttggctacgccacctacgca
tgggcaaagaagcacgacgcgtacatgaacagcaaagctggccacatcgcccacggttct
cacgaagagtaa

DBGET integrated database retrieval system