KEGG   Coprinopsis cinerea: CC1G_10306Help
Entry
CC1G_10306        CDS       T01275                                 

Definition
hypothetical protein
Orthology
K00418  
ubiquinol-cytochrome c reductase subunit 8
Organism
cci  Coprinopsis cinerea
Pathway
Oxidative phosphorylation
Metabolic pathways
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:cci00190]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 103 aa AA seqDB search
MRPTAARFSDMPGPKVYNLWWGDKTGTLRQKGITTYTISPYQTKTAPHWARNYLFNFYRR
IGGELLFFGIPFALGYATYAWAKKHDAYMNSKAGHIAHGSHEE
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccaccgctgcacgattcagtgacatgcccggacccaaggtctacaacttgtgg
tggggtgacaagaccggcactctcaggcaaaagggcattaccacctacaccatctcgcca
taccagaccaagaccgctccccactgggcacgaaactacctcttcaacttctaccgacga
attggaggagagctcttgttctttggcattcctttcgctcttggctacgccacctacgca
tgggcaaagaagcacgacgcgtacatgaacagcaaagctggccacatcgcccacggttct
cacgaagagtaa

DBGET integrated database retrieval system