KEGG   Coprinopsis cinerea: CC1G_10654Help
Entry
CC1G_10654        CDS       T01275                                 

Definition
histone deacetylase RPD3
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cci  Coprinopsis cinerea
Brite
Enzymes [BR:cci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CC1G_10654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 557 aa AA seqDB search
MSKRKVAYFYDPCGLTNIAADVGSYTYGLGHPMKPHRIRVTHDLVTAYDMLDQMHVLRPT
RATAETMTKFHTDEYVHFLNRVTPETAEELTYHGTRFLVGEDNPAFEGVFEFCSISAGGS
IGAAQRIASGAADIAINWAGGLHHAKKREASGFCYINDIVLGILELLRIYPRVLYIDIDC
HHGDGVEEAFYTTDRVMTCSFHKFGEYFPGTGTQEDRGRGKGKGYAVNVPLKDGITDESF
KSVFEPVISKILEVFKPSAVVLQCGADSLAGDKLGCFNLTMYGHAHCTQFLRKHNIPLIL
LGGGGYTVKNVARTWTYETACALGIENDIDVNLPWNPYFEWFGPRYRLEVAENNMDDLNI
KEGSLDKVRINALEQLRELTPAPSVQLQDVPRDSVGKHLGFGIDDGQPRDDLDERLAQHA
RYIYNLQESAEAPSSDSEEGSSDSDDSSASHWNRQRSRRIGTGKKRMSLLTNQYYDIPHE
YGFSPHDYHGHLSKTTRRRFFQSGSRWDENVEQVINDRMQSVNGYPRHSLSATMERGGSW
GDRGGEDDDWDGDVSMH
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacgcaaagtcgcttatttctacgatccttgcgggctaacgaacattgcagcc
gatgtgggttcgtatacgtatgggttgggccaccccatgaagcctcacagaataagggtg
acacacgatcttgtgacggcctacgacatgctggaccagatgcacgttttgcgaccaaca
cgcgcaaccgccgagacaatgaccaagtttcataccgatgaatacgtgcatttcctgaac
agagtaacgccagagacggcagaagagttgacgtaccatggaacacgattcctggtcggc
gaagataacccagcctttgaaggagtgttcgagttttgttcaatatcggcgggagggtca
ataggtgctgcgcaacgcattgcatctggagcggccgacattgccattaattgggctgga
ggcctgcaccacgccaagaagcgcgaagcctcagggttctgctacatcaatgacattgta
ctcggcatactcgaacttctacggatatacccccgcgttctgtacatcgacatcgactgc
caccacggagatggtgttgaagaggcgttctacacgacagaccgagtgatgacatgcagc
ttccacaagtttggagaatatttccctggaacgggtacgcaagaggatcgcgggcgtggc
aaagggaagggatatgcggtgaatgtaccgctgaaggatggtatcacagatgaaagtttt
aagagtgttttcgaaccagttatcagcaagattctagaagtgttcaaaccatcagctgtc
gtgctccaatgtggtgccgattccctcgcaggcgacaagctcggatgtttcaacctcacg
atgtacggccatgctcattgcacgcaattccttcgcaaacacaacatccctctgatcctg
ttgggcggtggaggttacaccgtgaagaacgtcgcccgaacgtggacatatgaaaccgcc
tgcgccctcggaatagagaatgatattgacgtcaaccttccctggaatccttacttcgaa
tggttcggacctagataccggttagaagtggcagagaacaacatggacgacctcaacatt
aaggagggaagcttggataaagttcgaattaacgcccttgagcaattgcgggaacttact
ccagctccctcggtgcagcttcaagacgtcccaagggacagcgttggaaagcaccttgga
ttcggtattgacgatggacaacctagagatgacctggacgagcgcctagcccaacacgcc
cggtacatctacaacttgcaagagtcggcagaagcgccgtcctctgattcagaagaaggc
tcttccgactccgacgactcctcagccagccactggaaccgacagcgttcgcgacgtatc
ggcacaggcaagaagcgcatgagcttgctcaccaaccaatactacgatatcccacacgag
tacggcttctctccacatgactaccacggccatctatccaagacgactcgccggcgcttc
ttccagagtggttctcggtgggacgagaatgttgagcaggtcatcaacgacaggatgcag
agtgtcaatggttatccgagacattctttgtcggcgacgatggagcggggtgggagctgg
ggagatcggggtggggaggacgatgactgggatggtgatgtgtcgatgcattag

DBGET integrated database retrieval system