KEGG   Coprinopsis cinerea: CC1G_11132Help
Entry
CC1G_11132        CDS       T01275                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
cci  Coprinopsis cinerea
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CC1G_11132
Enzymes [BR:cci01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     CC1G_11132
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     CC1G_11132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 178 aa AA seqDB search
MRAYYFDNIPGDQRLPHDSGRPVSEDTLRKLNISYWRIELDGYLPKLNAVAEERGYKNRD
FINVSKAGLGDSYEEKLKNFFSEHMHEDEEIRYVVDGSGFFDVRESPSDEWIRIGVEPGD
LLVIPAGIYHRFTLDENNYIKAIRLFQDEPKWIPYNRSEETEVNPHRINYLREIGVGA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcctattacttcgacaatatccccggcgatcaacgcctcccgcacgactcggga
cgcccagtttccgaagacaccttgaggaaactcaatatcagctactggcgaatcgaattg
gacggttatctacccaagctcaatgccgttgctgaagaacgcggctacaagaatcgcgac
tttatcaatgtttcgaaagctggtttgggagatagctacgaagaaaagttgaagaacttc
ttctccgagcatatgcacgaagacgaggaaattcgatatgtcgtcgacggtagcggtttc
ttcgacgttcgagagtccccatccgacgaatggattcgtattggtgtcgagcctggcgat
ctcctcgtcatccctgccggaatctaccaccgattcaccctggacgagaacaactacatc
aaggctatccggttgttccaggacgaacccaaatggattccttacaaccgcagcgaggag
actgaagtcaatcctcaccgaatcaactacctgcgggagatcggcgttggagcttga

DBGET integrated database retrieval system