KEGG   Coprinopsis cinerea: CC1G_11172Help
Entry
CC1G_11172        CDS       T01275                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
cci  Coprinopsis cinerea
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cci00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CC1G_11172
Translation factors [BR:cci03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CC1G_11172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 254 aa AA seqDB search
MADWDASSDEEVKAKSVPAPKPIVPVRVAKKWEGEDEDDKPASDWEDSSSEEEEVKPAVV
APPKKKGTLKAKLAEKEAMKAQKAANGEFDYDSDDVLDPREKARRDKEKELKADLNNAAD
LLGAAALGGTSSSELDSIISAQPRTKEDFQKLSTQIYEYIIKRHSTKPLYASFVEHLARE
MAQPLKDVEVRKVASGLTTLANEKQKEQRDRASGKKKKASAKPALGGAKSAKSVDTTVYD
EALDDFGNDPNDFM
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctgactgggatgcttcttctgacgaggaggtcaaggccaagtctgtgcccgctcct
aaaccgattgttcctgtgcgagtggcgaagaagtgggagggtgaagacgaggatgataag
cctgctagcgactgggaggattcatcatcggaagaggaggaagtgaaacctgctgttgtt
gcgccgccaaagaagaagggtactttgaaggccaaactcgcggagaaggaggccatgaaa
gcacagaaagctgcgaacggcgagttcgactacgattctgatgatgtgcttgatccaaga
gagaaggctcgacgtgataaagagaaggaattgaaagctgatcttaacaatgctgctgat
ttgctgggtgctgctgctctcggaggcacctcatcatccgagctcgattctatcatctct
gctcagcctcgaacaaaggaggatttccagaaactctcaacgcagatctacgaatatatc
atcaagcgacactcaacgaagcctttatatgcctcattcgtcgagcatctcgcacgagag
atggcgcaacccttgaaggatgtcgaagtgcgaaaggtggcgagcggtttgaccactttg
gccaatgagaagcagaaggagcagagggacagggcgagcggaaagaagaagaaagcttct
gcaaagcctgcgttgggcggtgccaagtctgccaagtcagtggataccacggtatacgac
gaggcactcgacgatttcggcaacgatcccaacgacttcatgtaa

DBGET integrated database retrieval system