KEGG   Coprinopsis cinerea: CC1G_11206Help
Entry
CC1G_11206        CDS       T01275                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
cci  Coprinopsis cinerea
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cci00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CC1G_11206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 2101 aa AA seqDB search
MDNIHRLKDALTRALARGPEEPHQGDRELFEEIMVQKPRLLKLFDVGPRNAQEQREVESG
KITIDGKQVAVNSDFARQVLLISQHLDCSEKHVASVLHSVMRNNTNLSPVDYIEATVREY
HARRRDLADSIGTLLAASLEGERPDAPPTLQRLRSFVRTEILPVEATPGGQTSFAHRIFK
EIQQLDNVIAKADIALKNATSNTVSPSAQGQGVLGYDILKGRRDSLNYERRKLAISLTTI
AQHGCIEPNEIRAFIDWLSDHPTHFLAYHILTAVFISFEPCDPDSPLGSLRSRVSTDQSL
LTYMSKKLSPSTTWKEPGLKAAILLKWTMFITDARHNDASLEHRAGFKNEELETQVWNAV
QGDAFTYLAITVARLSRKNEKEALPPSLVTSPVTETTEQPELPAQDSKLLLLSTFETLVR
SLITYASSELRKIKQRQEDVVLANARTERNRAASRYGAPSVPEPEKPAQQPRHDIAILYS
FIGLLFQALPQERALQFWGAGSVDASITYLEFVEATAGRLPAFLQWAVWSTSSQDLIMLT
ALYDMINGLAKGQQCSELAYNFLARGTGEVLPGSSISSSTAATPAISWTAIFGILDAWTN
AIANPKSNPQPQSLGLTSTFSHSIQNLAQPVPAQQPVISNKDVIFAQAFLRLLASVVRYS
INVRKAIAGHIHFRAIPTLANLIPLSVPLELKGALFDTLAAFCEPGGGSPGLEICRAVWT
SLERNEVINVRGQTGGFSTSLASGKGVEVELEQIEAVHRQYPATIPFLKLLSTLIHTAKR
LPERDRATGMIPSNTIPDTLGQPYRLPGVGPYTSFVIDNVFANIPNREYNDPSDRWRIND
LCLCYIERAVAGFNLESLVSLAEEGPLKTESIVPYLIHPGFDVMTRLLSTSPLQASLLSY
LVDALDGFEKGLADEEPAFRNTIIRVLRIVSRLLEIQDIFLDVLLPLLSEFNTAPYIGHL
HHRSYFTKFDQALSFDPRYTPAIAQYMEYSSHAEIVLLSVKVLTFLSTSPYFTNLVALID
RSPNSERILAAFVKTLEAELVPDITEAEINAELNSGAGAPTIDDASSSLDQAIRLASLDL
LIQDTSNSRSFPNLGHWLLFGSSKPLVEDPRALHARRTSIHVILELVNEGVPRIKDRRNP
EHRIQTIPLAISLPALAERCYRVIYQLCTHPRTSEFVTRYLRTREDFFARQISNISPGAP
ECPANIVIKVIYGDGSGVITTVEALSSFLRLRSYIFDLVALELHLLTSKGHHKSVTDLLE
ILFGIDVDYEEEHDFHTFREVGQSNMRIVDFFQSLLFEWQDTLQVNHVDLQYLAQLNLQA
SIRKDANGCEVVDRPTLLRMISTAKQTLLSQGSIATTAQNDQLNAEINYVLESCAIENHR
RQIAFSVATGFESWRRLLDLALTKCFDRLPHDRRENMLFDLLHVLPPAIRSPNIEEPTAV
LLSETTLSLITKLREDRRHQLVLQSGGVEGTGSLPAERLYSILRSIVEGILDSNHSELIR
GNLYGSLINFIHLVLVSDHDSSLSDDSKDVFNLDYSSRQGSPFSGSTRSLALVNSTGSSR
TAKVESGILSSLKPGLERLVAVVARDAIDGTEVWKTVAFMLLDAITQLSSLEKPHVALSA
LDRHGILTNFVRGLKDSDALLQSVLKPEPDDLNPLYVYEAKMSLFIRMAQTRSGAERLLE
AQLIPTLAQCDYLDAMPEADQAFMDHDSFLPSAIQRYHQLFTPAVQVVNAIIAVLGNKHT
TATNHALDFLSNHSSTIAILLKTQADYVPLSILEELHLVVNLCASVLPSVPRTDLLSANS
GFGVINAAILSLSTRTLGRGKAFDRVIPSTDSEVQASNVYAFGHGSLSKFDVMVQQKERL
LHKSVISYIGSASDFTEEDIHLVLSPITITPKRDDHGSRFSATIPTIGDALAALDDLSND
LAEILKQISDIGAELANKHHIGANEIQEILRDFDPALLQDLEIEQTRSLIYRELMRIRRS
VQNDARVVLDSLEMLMLLLWRHLNHYANPSNMNMPPAKASVANAMRLLQTADPVTFRSEA
GIKLAPILQKLAGLDFTPVASGKDWQDSQGYVEIMSRRLRDTAGLLDDNGGGDHEFDDEA
A
NT seq 6306 nt NT seq  +upstreamnt  +downstreamnt
atggacaacatacaccgtctgaaagacgccctgacaagggccttggcccgtggcccagaa
gagcctcaccagggggatcgggaactgtttgaagagatcatggttcagaaaccgcgtctg
ctcaaactgttcgatgttggtcctagaaatgctcaagaacaaagggaggtcgaatcaggg
aaaatcaccatcgacggaaaacaggttgcagtgaactctgactttgcccgtcaagttcta
ctcatttcccaacatctcgattgctcagaaaagcatgtcgcaagcgttcttcattccgtt
atgcgaaacaatacgaacctatctcccgtcgactacattgaagccacagttcgcgagtac
catgcacgaagacgggacctcgctgattccattggaaccctccttgccgcgtcccttgaa
ggcgagcgaccggacgcgcctccaaccctccaacgtctccgcagctttgtccggacggag
atcttgcccgtggaagctacacccggagggcaaacatctttcgcccataggatcttcaaa
gagatccagcagctcgacaatgtcatcgccaaagcagacatcgccctcaaaaatgcaaca
agtaacacagtatccccatcagctcaagggcaaggtgttctcggctacgacattctgaag
ggaaggagagactcactcaattacgaacgacgcaagctggccatttcgttgaccacaata
gcacagcacgggtgtatagagcccaacgagattcgagccttcatcgactggctgtctgac
catccaacccacttcctggcctatcacatcctcaccgccgtattcatcagcttcgaacct
tgcgaccccgattcacccctcggctcccttcgctcaagagtatcgaccgaccaatcactt
ctcacttatatgagcaaaaagctctccccgtcaacaacatggaaggagcccgggttgaag
gcagctatccttctcaaatggacaatgttcatcactgatgcacgccacaacgacgcgagc
ctggagcaccgagcgggtttcaaaaatgaagaacttgaaacccaagtatggaacgctgtt
cagggagacgcattcacctatttggccatcactgtcgcgcggttatctcgaaagaacgag
aaagaagcccttccaccatccctcgtcacctctccagtaaccgaaacaaccgagcaacca
gaactccctgcgcaagactcgaagttgctccttctctcgactttcgaaactctcgttcgc
tctttgatcacatatgcgtcctcggagctccgaaagataaagcaacggcaagaggacgtc
gtcctggcaaatgcgaggaccgagcgaaaccgggcagcctcacggtacggcgcgccttcg
gtaccagaacccgagaagccagcccagcaacccagacacgacattgccattctttactcc
ttcattgggttgctgttccaagctcttccgcaagagcgcgctctgcagttctggggagct
ggatcggttgacgctagcatcacctaccttgaatttgtggaagccaccgctggccgactt
cctgctttcctccaatgggcggtttggtcaacatcttctcaagacttgatcatgctgact
gctctttacgatatgatcaatggactggccaagggacagcagtgtagcgagctggcttat
aactttttagctcggggaactggagaggttcttcccggaagctcgatctcatcttcaacc
gctgcgactcccgctatttcatggactgccatctttggtatcctcgatgcatggacgaac
gcaattgcgaacccgaagagcaacccccaacctcaatccctcggcctaacctcgacgttc
tctcattccattcagaacctcgcccagccggtacccgcccaacagccagtcatcagcaac
aaagacgtcattttcgcccaggcattccttcgactgttggcctccgttgtccgatactct
atcaatgtacgcaaggccattgccggccatattcacttccgcgccatccctactctcgcc
aacctcattcccttgagcgtgccactggagttgaaaggcgcgctgttcgacacactcgcc
gccttctgcgaacctggaggaggaagccctggtttggaaatttgtcgagctgtgtggaca
tctttggagcgaaatgaggtgatcaatgttagagggcaaacgggtggcttctcgacatct
ctggcatccgggaagggagtagaagtagagttggagcagatcgaggcggtacatcgacaa
tacccggccacaattcccttcctcaaacttctgagcaccctcattcataccgccaagcgc
ctgccagaacgagatcgggcaactggcatgattccctcaaacaccatcccggacaccctg
ggccagccctaccgacttcccggagttggtccctacacctccttcgttatcgacaacgtc
tttgcgaacattccaaaccgagagtacaatgacccctcggacagatggcgcatcaatgac
ctctgcttgtgctacatcgagcgggccgttgctggctttaatctcgaatctttggttagc
ctggcagaagagggacctctcaagactgagtctatcgtaccctacctcatccatccaggg
ttcgacgtcatgactcggttgctgagcacttcacccttgcaggcgagcttgctctcatac
cttgtcgatgcactggatggattcgagaagggacttgcggacgaggagccagcgttcagg
aacactatcatccgagtgctccgaattgtttcaaggttgctggagattcaagacatcttc
ctcgatgtcctcctcccccttctgtccgaattcaacacggcgccctacattggtcatctc
catcatcgatcctacttcaccaagttcgaccaagccctgtccttcgacccgcgctacacg
ccagccatcgcccagtacatggagtacagtagtcatgctgagatcgtcctgttgtcggtc
aaggttctcaccttcctctccacctccccatacttcaccaacctcgtcgccctcatcgac
cgcagtcccaactcggaacgaatcctcgctgcattcgtcaagaccttggaagcagagctt
gtgccggatattaccgaagctgagatcaacgccgagctcaactctggcgcgggagcgccc
accattgacgacgcgagcagctccttggatcaggctatccgattggcgtcgttggatttg
ttgatccaggacacgagtaatagccgcagtttccccaatcttggccattggctccttttc
gggagtagcaaacctctggtggaagatccccgtgcattgcacgcgcgcaggacctcgatc
catgtcatcctggagttggtgaatgaaggcgtaccgcgtatcaaggatcgaaggaatcca
gaacatcgcattcaaaccatccctcttgccatctccctccccgcattggctgaacgttgt
tatcgcgtcatctaccagctctgcacgcacccacgaacgtccgaatttgtaacccggtat
ttgcgcacgcgggaggatttcttcgctcgtcaaatttcgaacatttctcctggagctcca
gagtgccctgcgaatatcgtcatcaaggtcatctacggagatgggtcgggagtgattacg
acggtcgaggcattgagctccttcctccgattgcgatcctacatcttcgaccttgtcgcc
ctcgaacttcacttgttgacgagcaagggacaccacaagagtgtcacggatctgctcgag
attctgttcggtattgatgtggattacgaggaggagcacgacttccataccttccgggag
gtcggccagtcaaacatgcgtatcgtcgacttcttccagtcgttgttgttcgagtggcag
gatacgttgcaagttaaccacgtcgacttgcagtaccttgctcagttgaacttgcaggcc
tcgatccggaaggacgccaatggatgcgaagttgtcgaccgccccacattgcttcggatg
atctccaccgccaaacagacactcctctctcagggaagcattgccacgactgcccagaac
gatcaactcaatgcggagataaactacgtattggagagttgtgcgatcgagaatcatagg
cggcaaattgcgttcagtgttgcgactgggttcgaatcatggcgccgtctcctcgatctt
gcgctcaccaagtgcttcgaccgactgccgcatgatcgcagggagaatatgttgttcgac
ctcctccatgtccttccacctgccattcgctcgcccaatatcgaagaacccaccgccgtc
ttgttgtcggaaaccacactttcgctcatcaccaagttgcgagaagatcgacgacatcaa
ctcgttttgcagtctggtggagtcgaaggaaccggatctcttccagccgaacgactttac
tccattctgcgaagtatcgttgaaggtatcctcgacagcaaccattcggaactgatcaga
ggcaacctctacggctctctcatcaacttcatccacctcgtcctcgtttctgaccacgac
agcagcctctcggacgattccaaggacgttttcaacctcgattattcttcaaggcagggt
agcccatttagcggcagtacgcgctccctcgcactcgtcaactcgactggttcctccaga
accgccaaggttgaatcgggaatcttgtcatccctgaagcccgggttggagaggttggtt
gctgttgttgccagggatgcgatcgatggaacggaagtttggaagacggtggcgttcatg
cttttggatgcgattactcaattgtcgagtttggagaagccgcatgttgcgctctcggca
ttggatcgacatggtattcttaccaacttcgtgaggggtcttaaggattcggatgccctg
ctacagtctgtccttaagcctgaacctgatgacctcaaccctctgtacgtctacgaggcg
aagatgtcgctgttcattaggatggcccagacgagatcgggagcggagaggttgcttgag
gcgcagctgatcccgactctcgcccaatgcgactacttggatgcgatgccagaagccgac
caagcattcatggaccacgactcgttcctgccttcggccatccaacgctaccaccaactg
ttcacccctgctgtccaagtcgtcaacgctatcatcgctgtcttgggcaacaagcatacg
acagctactaaccacgctctggacttcctctcgaaccactcctcgactatcgccatcctg
ttgaaaacgcaggctgattacgtgccactgtctatcctcgaggagctccacttggtggtt
aacctctgcgccagtgtcttgccatccgtccctcgaactgaccttctttcagccaactct
gggttcggcgtcatcaacgctgccatccttagtttgtccacaaggacccttgggcgaggc
aaagcctttgaccgcgtcattccttccaccgacagtgaagtgcaggcgagcaatgtgtat
gcctttggccacggttcgttgagcaagttcgatgttatggtgcagcagaaggaacgcctc
ttgcacaagagcgtgatttcgtatattggttcggctagtgatttcactgaggaggatatt
catttggtcttgtcgcctataactatcactcctaagcgtgatgaccatggctctcgtttc
tctgccacgatcccaacgattggcgatgccctcgcagcactggacgacctctccaacgac
ctcgcggagatcctcaaacaaatctcggacatcggagctgagttggcgaacaagcaccat
atcggggctaacgagatccaagagatcctccgcgatttcgaccctgcattgctgcaagac
ctcgagatcgagcaaacccgatctctcatttatcgggagctcatgcggattaggcggtct
gtgcagaatgatgcccgcgttgttttggattcactagagatgctcatgctgcttctctgg
cgccacctcaaccattatgccaacccaagcaacatgaatatgcccccggccaaagcctct
gtggccaacgcgatgcgactgttgcaaactgccgatcctgtgacattcagaagtgaggcg
gggatcaagttggctcccatattgcaaaaattggctggcctagactttacccctgttgct
agcggtaaagattggcaagacagccagggttatgtcgagattatgtctcgacgattgagg
gataccgctggccttttagatgacaatggtggtggcgatcacgaattcgacgatgaagcc
gcttga

DBGET integrated database retrieval system