KEGG   Coprinopsis cinerea: CC1G_11312Help
Entry
CC1G_11312        CDS       T01275                                 

Definition
glucose-6-phosphate 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cci  Coprinopsis cinerea
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CC1G_11312
Enzymes [BR:cci01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CC1G_11312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 292 aa AA seqDB search
MPVHQLPGKIILQHPEGPSLEILLYGATIVSWKSPSVENKELKERLFLSSKAILDGTKAI
RGGIPIVFPCFGAPQHPEHLKLAQHGFARTSLWTFRKILLDNEAGVSVQLTLDPTPEIAA
VYDRPFQLTYVVTLAQHQLSTDLHVANPSESATLQFQSLLHTYIAAPAQELTITPLQNVK
YYDKMESITEAQQTAKVETRAKVDVRRPTDSVYEDAPLDYTVSWPGGTVNIRAREFKDVV
VWNPGEGGKKIADMEDGGWNNYVCVEPGYVRGYVNLAPGQTWIGQQVITIKA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgccagttcatcagcttcccggtaaaatcattctccagcatccagagggtccctccctc
gaaatcctactctacggggccaccattgtgtcatggaaatcgcccagtgtcgagaacaaa
gaactcaaagagagactgtttctctcatccaaggcgatcctcgatggcaccaaagcgatt
cgaggcggcatccctattgtcttcccctgttttggcgcaccccagcatcctgaacacctg
aagctggcccagcacggatttgctaggacatccctgtggactttcagaaaaattcttttg
gataatgaagctggtgtctccgtccaactgactctcgaccccactccagagatcgctgca
gtgtatgacaggcccttccaactcacctatgtcgtcactctggcacaacaccagctttct
actgacctccatgtggccaacccctcggagagtgccacgctccaattccaatctctcctc
catacctacatcgccgcacctgcccaagagctcaccatcacgccgttgcagaatgtgaaa
tactatgacaaaatggaatctatcacagaggcacagcaaaccgcgaaggtggagacgagg
gccaaagtagatgtccgtcgtccaacagattccgtctacgaggatgcccctctggactac
accgtgtcttggcctggcggcaccgtcaacatccgggcgagagaattcaaagacgttgtc
gtctggaacccgggtgagggagggaagaagattgcagacatggaagatggcggatggaac
aactatgtctgtgtcgagcccggctatgttagaggctatgttaacctcgcccctggccaa
acatggatcggacagcaggttattaccataaaggcatga

DBGET integrated database retrieval system