KEGG   Coprinopsis cinerea: CC1G_11362Help
Entry
CC1G_11362        CDS       T01275                                 

Definition
galactose-1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
cci  Coprinopsis cinerea
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CC1G_11362
   00052 Galactose metabolism
    CC1G_11362
Enzymes [BR:cci01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     CC1G_11362
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 401 aa AA seqDB search
MRFIAFFASATGFLTLVSAQRPPRPSPDWPFDVTEIKAPDGSISASFVSIGATLTQLWVK
DRDGKARDVVLGYDDPSLLWSDPAHPVFGAMVGRTVMELGAYGTIIGTFSIPISKNPTPG
APGTYHIPTNDKGGAVALHGGLIGWDRRNFTLVAKSPTSVTYKHVDNGDEGFPGTVTAYV
THTVSRGGSLETRVRATATEKTPLMMTQHTYWNLDAFQNGVNDTLDHVLQIDSSKVIELN
ENAIPTGEFIDVTGTVFDFRKPQAHGARWDDVQGLCGGECTGYDHCWVYDSRDRRAANRP
RTSLWSPHSGIRMDIYTNQDALQIYSAYWMNTVRKKAHGGPELSYGRWSGIALETQGHVA
AINTPEWGVDHIYGKVAELGVVDGPNRPYEWKTTYKFSTVQ
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttatcgccttcttcgcgtctgctaccggctttctaactttggtctctgctcag
aggcctccgaggccttcgcctgactggccttttgatgtgacagaaatcaaggcgccggac
gggtccatttcggccagcttcgtttcgattggagcaacgctcacccaactctgggtgaag
gacagggatggaaaggcgagggacgtggttctgggttatgatgatcccagcctactttgg
tccgaccctgcccatccggttttcggtgcgatggttggccgcacagtcatggagctgggc
gcttatgggactattataggcaccttttccatccccatctccaagaacccgacgcctgga
gctccagggacataccatatcccaaccaacgacaaaggaggcgccgtggccctccatgga
ggtctcatcggctgggacaggcgcaactttacgctcgtcgcaaagtcgcctacgagcgtt
acttataagcacgttgacaatggagacgagggcttccctggaaccgtcactgcctacgtg
acacataccgtgtcaagaggaggctcgctggagacgcgtgttagggcgactgcgaccgag
aagacgcctttgatgatgactcaacatacctattggaaccttgatgccttccaaaacgga
gtcaacgacaccctcgaccacgttctccaaatcgactcgtcgaaagtcatcgagttgaac
gagaacgccatcccgactggtgaattcatcgatgttacagggactgtgtttgatttcagg
aagcctcaggctcatggagcgagatgggacgacgttcaaggactttgcggtggcgaatgc
acggggtacgaccactgctgggtatacgactcgcgcgaccggagagctgcgaaccgaccc
cgcacctcgctttggagtccccactctggaatccgcatggacatctacaccaaccaggac
gcactccaaatctactccgcatactggatgaacactgtcaggaagaaggctcacggcgga
cctgagctgagctatggacgctggtctggtattgcgcttgagacgcagggtcatgtcgct
gcgatcaatacgcccgagtggggtgttgaccatatttatggtaaagtggctgaacttggg
gttgtagatgggccaaatcgtccatatgagtggaagacgacgtataagttctctaccgtt
cagtag

DBGET integrated database retrieval system