KEGG   Coprinopsis cinerea: CC1G_11760Help
Entry
CC1G_11760        CDS       T01275                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cci  Coprinopsis cinerea
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CC1G_11760
Enzymes [BR:cci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CC1G_11760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 695 aa AA seqDB search
MAKAHLVPAIFSSLHRLSAYVFLKIIPTTIGPLVLPVFYVAYLISLVLCPAADSPTPAIT
APVQTSQDTKEANGDAKNIKEEKPLPPPPVTQPKQPSLVPSLLFSLKTRNWLPNALNVAI
NTILFAACVDLTLNPVFYPETDVAFARVGAVYPDAAKITVRFPSSEVTQQDVRILYREAD
SPLNGWKDGPVLSVSEEFDWVNTTRLKNLWPETVYEYTFSDMNRTLVDDAVPQRFQTFPD
ARFNSGSHFKFLVSSCITPNFPYKGPQERLMIKGFDLLAKYLTHEEESTEEAVNMTGSVS
NTTTADEPVAEQNATVPEVAEEQVPLVAPESAPSASSVISNLYKFMLFLGDFVYADVPFY
YGDDKDAYLRLYRRNYASPSFQKVYRNLPVFYAYDDHEIFNNYGGEGIDVAPYANATNGF
SLYNGDANYDPTVQGDHYYNFSYGDTAFFVFDTRRYRSNIDTTAPQDRTMLGPVQLEAFH
NWLARVNQTATFKFVVSSVPFTSLWGHDAQLDSWAAFAREKNQVLKALQSVPNVVILSGD
RHEFAVIEYAVPQHSEDKKGYVVREYSASPLNMFYIPFVKTLRMESEDVVVRRWNETRLT
EEGPVVEEKTELVPKERVLQYIPVGNVKWSSIEVDTRNQSHPVLRLEAVIDGKTAYQLET
IGTPVNHNNGKALISVPLGLKHFLGKLGFQSKRWF
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcccacctcgtcccagcgatattttcttcgctccatcgtctctcggcctat
gtctttttaaaaatcatcccaaccacaattgggcctctggttttgcccgttttctatgtt
gcatatcttatctcgttggtactttgtcctgccgcggactctcccaccccggcgatcacc
gcccctgtgcagacatcccaagacaccaaagaggccaatggagacgcgaaaaacatcaag
gaagaaaagcctcttccccctcctcctgttacccaacccaaacaaccttcactcgtcccc
tcgttgcttttctctttgaaaacgcgcaattggctccccaacgccctcaatgttgctatc
aacaccatcctattcgctgcttgcgtggacttgacactgaaccctgtgttttatcccgag
actgacgtcgcgtttgcgagggttggagccgtttatcccgacgcggcaaagatcactgtc
cggttcccttcctccgaggtcacccagcaggacgtccgcattttgtacagagaggcagat
tcgcctttgaatgggtggaaggatggcccggtcctctccgtttccgaagagtttgattgg
gttaataccaccaggttgaagaacctttggccggagactgtctacgaatacacgttttcg
gatatgaacagaacccttgtcgatgatgctgttcctcaacgcttccagaccttccccgat
gcaaggttcaactccggttcccacttcaagtttctggtgtcgtcgtgtatcacccccaac
ttcccgtacaagggtccacaggagcgtctgatgatcaagggatttgacttgctcgccaaa
tacctcacccacgaggaggaatcgacagaggaagctgtcaatatgactggatctgtctcc
aataccaccaccgccgacgaaccagttgcagaacagaacgccaccgtccccgaagttgct
gaggagcaagtgccccttgttgctccggaatccgccccttcggcctcttcagtaatctcc
aacctgtacaagtttatgcttttccttggtgattttgtctatgcggatgtgcccttctac
tacggcgacgacaaggatgcgtatttgcgtctttacaggcgcaattacgccagtcccagt
ttccagaaggtgtacaggaacttgccggttttctatgcttacgatgatcacgagatcttt
aacaactatggtggggaaggaattgatgtcgccccatatgccaacgcgacgaacgggttt
tcattgtacaacggggacgcaaactacgatcctacggtgcagggagaccattactacaac
ttcagctatggcgatactgcgttcttcgtcttcgacactcgccgctaccgatccaatatc
gacaccaccgcccctcaagaccgcacgatgctcggccctgtccaactcgaagccttccac
aactggcttgctagggttaatcaaactgcaaccttcaagtttgtcgtctcgtctgtgccg
ttcacctcgctttggggccatgacgcgcagctggattcgtgggctgcgttcgcacgcgag
aagaaccaggttctgaaagccttgcagagtgtcccgaacgtggtcattttgtcgggtgac
aggcacgagtttgcagtgattgagtatgctgtccctcagcactcggaggataagaagggt
tatgtggttagggaatattcggcgagtccgttgaatatgttctatatcccgttcgtgaag
acgttaaggatggagagtgaggacgtggttgtaaggaggtggaacgagactaggttaaca
gaagagggacctgttgtggaggagaagaccgagcttgtgcccaaggaacgggtgttgcag
tatattcctgtggggaacgtgaagtggtcctccatcgaggttgatacgaggaaccagagt
catcccgttttgaggcttgaggctgttattgatgggaagactgcttaccagttggagacg
attggcacacctgtcaaccataacaacggcaaggccttgatttctgttcctctcggcctc
aagcacttcctcggaaaacttggtttccagtcgaaacgatggttctaa

DBGET integrated database retrieval system