KEGG   Coprinopsis cinerea: CC1G_11834Help
Entry
CC1G_11834        CDS       T01275                                 

Definition
hypothetical protein
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
cci  Coprinopsis cinerea
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cci00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 982 aa AA seqDB search
MNVHDLSRDDDFLSHLLVEKLGTGQVPLVVHKMDPSARLPKTDADELMSLVRRFVITKAP
VQQAVRQAVDELLTFPAVRYYLKSYTQKQINAFATHASRYFELYHPSGVIEIAHTSRYSS
HTGKSELCVLATRPLSPGMVITELKGSMANLTDEEDKELKRAGMVNSDIRRDFSVIHSKS
MKKNHLFLGPARFVNHDCDNNCELFREGRYITFRVLRPIAVGEEITAHYGDGYFGKKNKH
CLCETCEKNGRGGYAPVDPDDDGTSSSSSDSDSESDSESSSSDAESEAEAEPILNLNERR
TRRGVYAITAAKDEDSEDSENENDDDNTVPLAGARDIPADSEVELTADLDSASELTSLPT
SNPPSDTHSLSSLSSLPVSRSSSSLTSLSSSSSDEAKVAASLTTTTTRRQSREAASRAST
SQLSSTPLRRSTRATNSLLASSRRSTPVNGKERATRTPVSNSSSARGRNTPRREDTVVKE
EAEQRVLRMRPSGPNAAEPSKEGPEKEPPRGPDGKILPTCSTCGNILPVILVDSKVVWGL
GLDSKKAKKKKQDCPRYLLNFRRFIGPKLTQEPRCMRHFAIYQQTWPSRVPGPGAVLPPP
RATTPSDPVAKSSKKVLKYLQKQAEVSRSLAASKATNKREREQAVEENPRAQKKLKADPP
PPLVKLKQTPVSNSTSTSTTESEPVKRKRGRPRLSSPRFRPKVKPLSEVVVKVEEEAPEI
PAKRVFSQPRAQNGRFGKKDKSQKKKPADSATPRSPRVKKDVPTSPTWTSPRRKRANDDN
EDVQMAEDSPKRKHVRTEEMEEPNEKEESSAPKPHQRVMPRPTSTFRGPKLFSNPSPLNF
ALHAWAGPVILDESSEDEESSTPETPEDIQSPGPEIAEDPELNASTLLPAPVHRAPLIYK
PSPFTFSKRRWVSLPQLPERLASGDSVVDDKEDDDDDKEEEEDVENIPEHAVSSRKERSS
SASGHSFTPRWTKSFLVNNDVS
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttcacgacctctcccgggacgacgacttcctcagccacctcctagtcgagaaa
ctgggaactggtcaggtaccgctggtcgttcataagatggacccttcagcaagactgccc
aaaaccgacgccgatgaactcatgagtctcgttcgacgctttgttattaccaaggcgccc
gttcagcaggcagtacggcaggccgtcgacgaactcctcacctttcccgccgttcgctat
tatttgaaatcatatacccaaaagcagatcaacgccttcgccacacatgcttccaggtac
ttcgagctctaccacccttctggggttatagaaatcgcccacacttctcgttattcttcc
catacagggaagtccgaactatgcgttctagccacacgacccctttccccaggaatggtc
attaccgaactgaagggctccatggctaacttgacggacgaggaggataaggagttgaag
agggctggtatggttaattcggacattcgaagggatttcagcgttatccactcaaagtcg
atgaagaagaatcatctattcctgggacctgccagattcgtgaatcatgactgcgacaac
aactgcgaattattccgggaaggccgctatatcacattcagagttctcagacctatagct
gtaggcgaggagataacagcgcattatggggacggttactttggcaagaagaacaagcat
tgcctgtgcgaaacatgcgagaagaatggacgtggtggatacgctccagtggacccagac
gacgatgggacttcgtcttctagctcagattcggattcagagtcagactctgaaagttca
tcgagcgacgccgagagcgaggccgaggcggagcccatactcaatctcaacgagaggcgg
accaggcgcggtgtttacgctatcaccgctgccaaggatgaagatagcgaagatagcgag
aacgagaacgatgacgacaacactgtaccactagccggagcgcgagatatcccagccgac
agtgaagtcgagctgaccgcagatctggacagcgcctcagagctaacttcattacccacc
tccaaccccccgtccgacacacattctctctcatccctttccagcctacctgtctctcgt
tcatcgtcttcccttacctcgctgtcctcttcgtcctcagacgaggcgaaggtagcagct
tccctcactacgaccacgacgcggcgtcaaagtagggaagccgctagcagagccagcact
tctcaactgtcgtcgactcctcttagacgctccacccgagccaccaattcccttctcgcg
tcgtcgcgtaggtccactcctgtgaacggaaaggagcgcgccactaggacaccggtctcc
aattcgtcgtccgcccgtggtcgcaatacgccgcgaagggaggacaccgtcgtcaaggag
gaagcggaacagcgagtccttcgcatgcgcccgtcaggtcctaacgctgcagagccttcc
aaggaaggtccggagaaggaaccccctcgaggtccagatggaaagatattgccaacttgc
tccacatgtggtaatatccttcctgttatcctggtcgactccaaagttgtctggggccta
ggtcttgacagtaagaaggcgaagaagaagaagcaggattgcccaaggtatctcttaaat
ttccgtcgattcataggaccaaagctcacgcaggaacccaggtgtatgcgccattttgcc
atctaccagcaaacatggccatctcgggtcccgggacccggcgccgttcttcctccccct
cgtgcaactaccccctctgaccctgttgccaagtcctcgaagaaggttctcaaatacctt
cagaaacaggcggaagtgtccaggtcgttggccgcatccaaggcgacaaataagcgcgag
agggagcaggcggttgaggagaatccccgtgctcagaagaagctgaaagcggatcctcct
cctccgcttgtcaagctcaagcagactccggtttccaactccacttccacatcgaccacc
gagagcgagccagtgaagcgaaagcgtggacggccccgtctgtcctcccctcgcttccga
cccaaggtgaagcctctctcggaggtcgtcgtgaaagtagaagaggaagctcccgagatt
cctgctaaacgcgtcttttctcagccccgcgcccagaatggacgtttcggaaagaaggac
aaaagtcagaagaagaaacccgcagattccgctactcccaggtcacccagggtcaagaag
gacgtaccgacctcgcccacctggacctcgccacgccgtaaacgcgcgaacgacgacaat
gaagatgtccagatggcagaagattcgccgaagaggaaacacgttcgtacggaagagatg
gaggaaccaaacgagaaggaggaatccagcgctccgaaaccacatcagcgggtcatgcca
cgccccacttcgactttcagaggaccgaaacttttctcaaaccccagccccctgaacttc
gcattgcatgcctgggctggcccggttatcctggacgagtcgtcggaagacgaagaaagc
tccacgcctgaaacccctgaagatattcaatctccaggccccgaaatcgcagaagacccc
gaactcaacgcttcaacactcctaccagcccctgtccaccgcgcaccacttatttataag
ccttcgccattcacattttccaaacgccgttgggtgtctttaccccagctcccggaacgc
cttgccagtggcgacagcgtcgtcgacgacaaggaagatgatgatgacgataaagaggag
gaggaggatgtcgagaacatacccgagcatgctgttagctctagaaaggagaggtccagc
tccgcgagcggacattcgtttactccccgctggacaaagtccttccttgtaaataacgac
gtgagttaa

DBGET integrated database retrieval system