KEGG   Coprinopsis cinerea: CC1G_12049Help
Entry
CC1G_12049        CDS       T01275                                 

Definition
glycogen debranching enzyme
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
cci  Coprinopsis cinerea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CC1G_12049
Enzymes [BR:cci01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CC1G_12049
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     CC1G_12049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1598 aa AA seqDB search
MSQNPNKQRGPGTIDVANLNNGTNGSSPPTSSSSPAAPKTPAEEGIQFFSGEVKPGEQPI
RVYELFLEDDGGPGKDMQYIRLPPAYTPYILRVSIEAGTPAAKNGVFKTNFPLDGKTFGR
SRFTEKKLPQDFSKPIQIDLPIAQAGAYKYWVEYEGTDGSRIKGREGFFNIDPVLRLKSR
SRILSPSLSVLPPSEGGAIQDDYINLPQDGLSVLTVVSKWMGPLSEWHKHFQEAKERGYT
MLHYPPLQERGESNSPYSIRNQLGYDKDLFGNGAPKDGKSAQQEVEKILRLAREEYGLLS
LTDVVLNHTANDTPWLSEHPEAGFSPANTPHLTPALELDTAILEFSEKLEANGLPTVIKS
DDDLIRITEAFEKTVRSLNLWQYYVLNAAREKESVKEALNSGQVTPWSGSLVANKTVEEL
AHILREEKGVIKGLSQYASRFGVHVEPGIAAGFIKAAFTHLSDNEALAEAWGRVVDVINV
PLYEEWEADTRVAVESVKNRVKYTRLDEHGPKLGEISKWQPLVEPYFTRVTPPQGKPADP
QTYSLANNGWIWGADPLKNFALLPSKAYLRREVIVWGDCVKLRYGSQPSDNPWLWDYMTS
YVQVLARTFDGFRIDNCHSTPLEVGTHMLDAARVVKPNLYVCAELFTGNEETDLVFVREL
GINSLIRESYNGWDPKEYSRLLYRFGLGKPIGSMDAACLTSKAEIPSPTGKGPHREAIIS
PIKGSLPHALLYDLTHDNESPHDKRSAEDALSTGALAAFSMCGTGSVKGFDDLYPKLVDL
VREKRKYELTGLGEHSGIAKIKRVVNGLKLEMVIDGFEEGHVHQENDYIVLHRVNPRTQK
GYLLVAHTAFHKGKKDRGHIDPIKLRRTRAKYILGASISISSYTPSKDSTTLKGLPSTLV
DIPSSSVPIHTSSDSSGPYSEITVPQTFPPGSIMIFETQIEDFDADLEELCLQGAYESVK
DLDLVDLNVILHRADVEEKDATDGKYGAYDVPGLGKMVYCGLEGWMHPLRHVMKWNDLGH
PLCAHLREGTWAFDYLWQRLDAQVGTFPNLAKPAQWLKERCERVKSKVPTFMRPKYFALI
VSEAYKAARLAVVEQCSDFVVSGHSFIQDLALCSVQMHGLVKSASLDPEVNTPSLAAGLP
HFTTGWARCWGRDVFISLSGLFLTTGNFEGARRHILAFATTLKHGLIPNLLDSVRNPRYN
SRDSPWWMLQNIQDYVKRAPDGLSILSETIKRRFPKDDTYVPWDDPLAYSQTSTIAEIIQ
EILERHAQGISFREHNAGPNLDMQMKPEGFDINVYVDWETGFVLGGSKHNCGTWMDKMGE
SVKAGTKGVPGSPRDGADVEIIGLLKSTLRWVSELSAKGQFPFKGVTAKVNGQDKFVTYK
EWSDLIQASFEKYFYVPLDPAEDVNYKIDTKLVNRRGIYKDVYGSGADHAWADYQFRCNF
PIAMTVAPEMFDPQHALGALKLADEVLRGPLGMKTLDAQDLQYRPVYDNQNDSDDASVAK
GLNYHNGPEWGWPLGYFLRAYLHFDLIAGEGKTNPQQTLHKLYGKLLTPRHHIQKDPWRG
LPELTNANAEYCRDSCPTQAWSASTLLDFLDDVHNLSL
NT seq 4797 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagaacccgaacaaacagaggggtcctggaacaatcgatgtcgccaatctcaac
aacggcaccaatggctcgtctccaccgacgtcctcgtcgagccctgcagcacccaagact
ccagctgaagagggcatccagttcttctccggcgaggtcaagcctggcgaacagcccatc
agagtctacgagctctttctagaggacgatggaggccctggaaaagacatgcagtacatc
cgccttccaccggcctataccccctatatcctacgagtgtccatagaggcaggcacacca
gcggccaagaacggcgtcttcaagaccaacttccccttagatgggaaaaccttcggaaga
tcgaggttcacagagaagaaactacctcaggacttttcaaagcctatccaaatagacctt
cccatcgcacaggcaggagcttacaagtactgggtcgagtatgaaggcaccgatggttcg
cgtatcaagggcagagaaggcttcttcaatatcgatcccgtgctccgcctcaaatcccga
tcgcgcatcctctccccttctttatccgtccttccaccatccgaaggcggcgccatccaa
gatgactacatcaatcttcctcaagatggcctctccgtcctcacagtcgtctccaaatgg
atgggtcccctgtctgaatggcacaaacacttccaagaagcaaaggagagaggatatacc
atgttgcactaccctcctcttcaggaacgaggcgaaagcaacagcccttactccatccga
aaccaactcggttacgacaaggaccttttcggcaacggcgcgcccaaagacggcaagagc
gcacagcaagaagttgagaagatcctcaggctcgcaagggaggaatacggactactcagc
ttgactgacgtcgtgctcaaccacaccgccaacgacaccccttggttgtctgagcaccct
gaagctggtttcagtcccgccaacaccccgcacctcactcctgctctcgaactcgatacg
gccatccttgagttctcggagaaactagaggcaaacgggttacccacggtaatcaaatca
gacgacgatctcatccgcatcaccgaagcgttcgagaagacagtccgctcgctcaacttg
tggcaatactacgtcctcaacgctgcacgcgagaaagagtccgtcaaggaagccttgaac
tctggtcaagtcaccccctggtcaggttctcttgttgccaacaagactgtcgaagaacta
gcccacatccttcgcgaggagaaaggtgtcatcaagggtctcagtcaatacgcgtctcgt
ttcggtgtccatgtcgagcctggcatcgctgctggattcatcaaggctgctttcacacac
ctcagcgacaatgaagcgctagctgaagcatgggggcgcgtcgttgacgtcatcaacgtg
ccactctacgaagaatgggaggcagatacaagagtcgctgtcgagagcgtgaaaaaccgc
gtcaagtatacccgactcgacgagcacgggcccaagttgggtgaaatttcgaaatggcaa
ccccttgtcgagccctacttcacacgcgtcactcctccgcagggcaaaccagcggaccct
cagacttactctctcgccaataacggttggatctggggtgctgacccactcaagaacttt
gctctcctcccctccaaggcctaccttcgacgtgaagtcatcgtatggggcgactgcgta
aaactgcgctacggctcccaaccctctgacaacccctggctctgggattacatgacatcc
tacgtccaagtccttgcccgcacattcgacggattccgtattgacaactgccactccacc
ccactcgaagtcggaacccacatgctcgacgcagcacgcgtggtcaaacccaacctctac
gtctgtgctgagctcttcacagggaacgaagagaccgatctcgtctttgtacgcgagttg
ggtatcaacagtcttatccgagaatcctataacggctgggaccccaaggaatactcgcga
ctcctctaccgattcgggctgggcaaacctattggttcaatggacgcagcgtgtcttacc
tccaaggccgagatacctagcccaacaggaaagggaccgcaccgcgaggcaattatctca
cctatcaagggttcgctcccccacgccctcctctacgacctcacccacgacaacgaatct
ccccatgacaaacgaagtgctgaggatgcactgtccacaggtgctctagccgctttcagc
atgtgcggaacgggaagcgtcaaaggctttgatgatctctatcccaagctcgtcgatcta
gttagggagaagagaaaatacgagcttacagggcttggagagcatagcggaatcgcgaaa
atcaagcgagttgttaatggtttgaagctggagatggtcatcgatggattcgaggaagga
cacgtccaccaggagaatgattacatcgtacttcaccgggtgaatcccaggacccaaaag
ggttatctcctcgtcgcacacaccgcattccacaaaggaaagaaggatcgcggacacatc
gaccccatcaagcttcgtcgtacccgagccaaatacatcctcggtgcctcaatctccatc
tcatcgtatacgccgtcgaaggattccaccaccctcaaaggcctcccctctactctagtc
gacataccctcttcctctgtcccaatccacacatcctctgactcctctggaccctactcc
gaaatcaccgtacctcaaacgttccccccaggcagcatcatgatcttcgaaacacagatt
gaagactttgacgcagatctcgaggagctctgtctccaaggcgcctacgaatccgttaaa
gaccttgacctcgtcgacttgaacgtcatccttcaccgtgccgatgtcgaggagaaggat
gctacggatggcaagtatggtgcttacgacgtacctgggctgggtaagatggtatactgc
ggattggaagggtggatgcatcccttgaggcatgtcatgaagtggaatgatctcggacac
cctctgtgtgcacatttgagggagggaacttgggcatttgactacctgtggcagcgactc
gatgcacaagtcggaacattccccaacctcgccaaacctgctcaatggctcaaggaacgt
tgcgaacgcgtcaaatccaaagtccccaccttcatgcgtccaaagtactttgccctaatc
gtctctgaagcatacaaagcagcacgactcgcagtagtggagcaatgttccgactttgtc
gtctccggacactcgttcatccaagacctcgcactgtgctctgtccagatgcacggattg
gttaaatcagctagtctcgatcccgaggtcaacacgccttctttggccgctggtttgcct
cactttactactggctgggcgagatgctggggtcgcgacgtcttcatttcactgagtggt
ctgttcttgacaactggtaattttgaaggagcgaggagacacattctggcgtttgcgacc
accctgaagcacggtctcatccccaacttgttggattcggttcgaaatcctcgctacaac
tcccgcgattcaccctggtggatgctccaaaacattcaagactacgttaaacgcgcaccg
gacggactgtccatcctctctgaaaccatcaaacggcgcttccccaaggacgacacctac
gtgccctgggacgatcccctcgcctactcccagacctccaccatcgcagaaatcatccaa
gaaatcctcgagcgacatgcacagggtatctccttccgtgaacacaatgccggtcccaac
ttggatatgcagatgaagcctgaaggtttcgatatcaatgtgtacgtcgactgggagaca
ggatttgtgcttggaggaagcaagcataactgtgggacgtggatggacaagatgggagag
agcgtcaaggcgggtacgaagggcgttcccggttcccctagggatggagcggacgtggag
atcattggattgttgaagagcactttgaggtgggtgagcgagctgagtgcaaagggccaa
ttcccgttcaagggcgttactgccaaagtgaatggccaagacaagtttgtgacatacaag
gaatggtcggatttgattcaagcttcgtttgagaagtacttctacgtacctcttgatccg
gcagaagacgtaaactataagatcgacaccaagctcgtcaaccgacgtggaatctacaag
gatgtctacggttcaggtgctgaccatgcctgggcagattaccaattccgatgcaacttc
cccatcgccatgactgtcgctcctgagatgttcgatcctcaacatgccttaggtgccctg
aagcttgctgacgaggttttgaggggtcctctgggcatgaagacactcgacgcgcaggac
ttgcagtacagacctgtgtatgacaaccagaatgactctgacgacgccagtgtcgcaaag
ggtctgaactatcataatggaccggaatggggatggccgctcggatacttcctcagggcc
tacctccactttgacctgatcgcgggagagggcaagacgaacccccaacaaaccctccac
aagctctacggaaagctacttacaccgcgtcatcatatccagaaagacccttggcgcggc
ctacccgaactgacgaacgcgaacgcagagtactgtcgagattcgtgccccacgcaggca
tggagcgcgagcacgctgcttgatttcctggatgacgttcacaacctatctctctag

DBGET integrated database retrieval system