KEGG   Coprinopsis cinerea: CC1G_12361Help
Entry
CC1G_12361        CDS       T01275                                 

Definition
xylanase glycosyl hydrolase family 10
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cci  Coprinopsis cinerea
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 341 aa AA seqDB search
MKTTATFAFLMALTVQGVVGQLALLSKLAGKQYFGTAIDYVAINDTAYMKKSGDRWEFDT
ITPSNSMKWETIQPEQGVWNFGPADELVAFAKKNRQAVRGHTCLWHSQLAPWVEAGNFDS
ETLHEIIHEHCYKLVSHYKGDVFHWDVVNEAFLDDGTFRPTVFYNTTGTTYFDTVFKAAR
AADPKAKLYINDYNLEGLSPKSDAVYELVKDLKSRGIPIDGVGVQGHLILGQIPTTIREN
FQRFADLGVDVAITELDIRMDLPVTREKLAQQKKDYEAVVSACKAVKRCVGITIWDWTDK
YSWVPGWFEGEGAALPWDEDFKKKPAYYGIVEGLIKPVRRK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccacggctacctttgctttcctcatggccctcactgtccagggtgtcgttgga
cagttggccctcctctccaagttggccggcaagcagtactttggtaccgccatcgactac
gtcgctatcaacgacacggcctacatgaagaagtccggtgacaggtgggagttcgacacc
atcaccccttcgaacagcatgaagtgggagaccatccaacctgagcaaggcgtctggaac
ttcggccctgcagacgaactcgtcgccttcgccaagaagaacaggcaagccgttcgtgga
cacacttgcctctggcacagtcaactcgctccatgggtcgaggccggcaacttcgacagc
gagaccctgcatgagatcatccacgagcactgctacaagttggtgagccactacaagggc
gacgtgttccactgggatgttgtcaacgaggccttccttgatgacggaaccttccgcccc
accgtgttctacaacaccacgggaaccacctatttcgacactgtcttcaaggctgcccgg
gctgctgatcccaaggctaagctctacattaacgactacaacctcgagggactaagcccc
aaatctgacgctgtctacgagctcgtcaaggacctcaagtctcgcggcatccccatcgac
ggcgttggtgtgcaaggccatctcatcctcggacagatccccaccaccatcagggagaac
ttccagcgcttcgccgacctcggcgtcgacgttgccattactgagcttgacatccgaatg
gacttgcctgttactcgcgagaagttggcccaacaaaagaaggactacgaagccgttgtg
tcagcttgcaaggctgtgaagcgatgcgttggtatcaccatctgggactggaccgacaag
tactcctgggttcccggctggttcgagggtgagggtgccgctctcccttgggacgaggac
ttcaagaagaagcccgcttactacggtattgtcgagggtctcatcaagcccgttcgcagg
aagtag

DBGET integrated database retrieval system