KEGG   Coprinopsis cinerea: CC1G_12474Help
Entry
CC1G_12474        CDS       T01275                                 

Definition
xyn11C
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cci  Coprinopsis cinerea
Brite
Enzymes [BR:cci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     CC1G_12474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 218 aa AA seqDB search
MKLLYLLALPLVLLIQGAFTAPTPDNSTTLERRQAASFWTNWSEGNIGVRCTPGAGGSYT
ATWGGSTGGFVCGKGWSRGGSRAVTYSGTYNATGPGYLALYGWTRNPLIEYYVIESYAVL
APGEPWTYRGVFTSPEGTYEMYESTRVNKPSIEGTRTFQQYWSVRTEKRVGGTISTQRHF
DEWARVGMRLGWHDYMVFATEGFTNGQYSSGSSSINVS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgctctatcttcttgcgttgccattggtccttctgattcaaggagcgttcacc
gcccctactcctgacaactccacgactctcgagcgtcgccaggccgcatccttctggacg
aactggtccgaaggaaacattggcgttcgatgcacacccggtgctggaggatcatacacc
gcaacttggggtggttcgaccggcggttttgtatgtggaaaaggatggagccgaggagga
agcagggcagtcacatacagtggaacgtataacgccactggtcctggctatctcgctctc
tacggttggacgaggaaccctctgatcgaatactatgtcatcgaatcctacgctgttctc
gctccgggcgagccatggacttacagaggcgtgttcacttctccggagggaacctacgag
atgtacgagagcacgcgtgtcaacaagccttcgatcgagggtacgaggaccttccagcag
tactggtccgttcgaacagagaagcgcgtcggcggcacgatttccacccagaggcacttc
gatgagtgggctagggttggcatgagattggggtggcacgactacatggtcttcgcaacg
gaaggattcaccaacggacaatacagtagcgggtcgtcttctattaacgtgtcctaa

DBGET integrated database retrieval system