KEGG   Coprinopsis cinerea: CC1G_12569Help
Entry
CC1G_12569        CDS       T01275                                 

Definition
Poly(A)+ RNA export protein
Orthology
K14298  
mRNA export factor
Organism
cci  Coprinopsis cinerea
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cci00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CC1G_12569
Messenger RNA biogenesis [BR:cci03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     CC1G_12569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 353 aa AA seqDB search
MSFFGATTSTTAASTAADKDVEVAEPPTDSISSVSFSPQADYLAVGSWDNSVRIYEVGPQ
GQTQGKAMYQHQGPVLDVCWNTDGTKIFSGGADNAGRMFDVTTGQATQVAQHDAPIKVVG
WVNAPQAGVLATGSWDKTIKYWDLRTPNPVATVTLPERCYTFDIQYPLMVVGTAERHIQI
YNLNSPNTVFKNLTSPLKWQTRVVSCFTASQNSGFAIGSVEGRVAIQYVEDKDSSNNFSF
KCHRRDSVPNSKDQAMVFAVNDISFHPVHGTFSTCGSDGTIHFWDKDARTRLKTFEAAPG
PISTTAFNRNGTLFAYAISYDWSKGHSGMTPGHPNKLMLHQCKDEEVRKRNRK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttctttggagccaccacgtcgacaacggcggcttcgactgccgcggacaaagac
gttgaagttgctgagccgccgaccgattcaatttcttcagtctcgttctcaccacaagcc
gactatcttgcagttggaagctgggacaatagcgtccggatatatgaagtcgggccccag
gggcagacccaaggcaaggctatgtatcagcatcagggccccgtcctagacgtttgctgg
aacacggatggaacgaaaatcttctctggaggcgcggataacgctgggagaatgttcgat
gttacgactggacaggccacccaagtcgcccaacacgatgctccaatcaaggttgtcggc
tgggtgaacgctccccaggctggagttttggcgaccggtagctgggacaaaaccatcaaa
tactgggacttgcgtactcccaaccctgtagctaccgttacacttccagaacgatgctat
acgttcgacatccaataccctttgatggtcgttggaaccgccgagcgacacattcaaatt
tataacctcaacagccccaacactgtcttcaagaatttgacctcccctttgaaatggcaa
actcgtgttgtgtcttgcttcacagcatctcagaatagcgggttcgcaattggaagcgtt
gaaggtcgagttgctatccaatacgtcgaagacaaagactctagcaacaacttctcgttc
aaatgccatcgccgagactctgtccccaactccaaagaccaagccatggtattcgcagtg
aacgatatttcattccatcctgtccatggcaccttctcgacttgcggttccgacggcacc
atccacttctgggataaggatgcacgaactcgactaaagaccttcgaagcagcacctggg
ccgatatccacgaccgccttcaaccgcaacggtaccctcttcgcctacgccatctcatac
gattggtccaaaggccactccggcatgactcccgggcaccccaacaagttgatgctgcac
caatgcaaggatgaggaagtcaggaagcgcaatagaaagtaa

DBGET integrated database retrieval system