KEGG   Coprinopsis cinerea: CC1G_13164Help
Entry
CC1G_13164        CDS       T01275                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cci  Coprinopsis cinerea
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CC1G_13164
Enzymes [BR:cci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CC1G_13164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 204 aa AA seqDB search
MCIRPDFLRPLVLSGPSGVGKSTLLKRLFADFPDKFGFSVSHTTRAPRPGEEDGTHYHFV
AQDHFRKLLDEKAFIEHAEFSSNFYGTSFEAVRRVQQQGRRCILDIEAQGVRQIKNTDLN
PVYLFISPPSLATLRARLRGRGTETEASVEKRLNMALKEVDYAKQPGVHDIVIVNDDLDR
AYELFKQVALGERIPGDPLPPLDD
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtgcattcgtccagatttcctgcgtcccctcgtcctctcaggcccatccggagtcggc
aagagcactctcctcaagcgtctctttgccgactttccagacaaatttggcttcagcgtc
tcccacacaacccgcgcgcccagaccaggcgaagaggatggcacacactaccactttgtc
gcacaggaccacttcagaaaactattagacgaaaaggcctttatcgagcacgcagagttc
tccagcaatttctatggtacaagcttcgaggccgtccgacgtgttcagcaacaggggcgc
agatgcattcttgatatcgaggcacagggcgtccgccaaattaaaaacacggacctcaac
cccgtctatctcttcatctcgccgccatccctcgcaactctgcgcgcccgcctgcgtggc
cgaggaaccgagacagaagccagcgtagagaaacgcctcaacatggctctcaaggaggtc
gactatgcaaaacagcctggtgtccacgatattgtcatcgtcaacgacgacctggaccgt
gcctatgagctgttcaaacaggtggccctgggagagcgcatacccggcgatcccctaccg
cctctagacgactag

DBGET integrated database retrieval system