KEGG   Coprinopsis cinerea: CC1G_13164Help
Entry
CC1G_13164        CDS       T01275                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cci  Coprinopsis cinerea
Pathway
cci00230  Purine metabolism
cci01100  Metabolic pathways
Module
cci_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CC1G_13164
Enzymes [BR:cci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CC1G_13164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 AAA_18 AAA_22 RsgA_GTPase RNA_helicase ATPase_2 ABC_tran NACHT AAA_29 MMR_HSR1 AAA_5 AAA_28 AAA_14 AAA AAA_24 NTPase_1 Roc Pox_A32 Rad17
Motif
Other DBs
NCBI-GeneID: 6008002
NCBI-ProteinID: XP_001831529
UniProt: A8N9M3
Position
7
AA seq 204 aa AA seqDB search
MCIRPDFLRPLVLSGPSGVGKSTLLKRLFADFPDKFGFSVSHTTRAPRPGEEDGTHYHFV
AQDHFRKLLDEKAFIEHAEFSSNFYGTSFEAVRRVQQQGRRCILDIEAQGVRQIKNTDLN
PVYLFISPPSLATLRARLRGRGTETEASVEKRLNMALKEVDYAKQPGVHDIVIVNDDLDR
AYELFKQVALGERIPGDPLPPLDD
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtgcattcgtccagatttcctgcgtcccctcgtcctctcaggcccatccggagtcggc
aagagcactctcctcaagcgtctctttgccgactttccagacaaatttggcttcagcgtc
tcccacacaacccgcgcgcccagaccaggcgaagaggatggcacacactaccactttgtc
gcacaggaccacttcagaaaactattagacgaaaaggcctttatcgagcacgcagagttc
tccagcaatttctatggtacaagcttcgaggccgtccgacgtgttcagcaacaggggcgc
agatgcattcttgatatcgaggcacagggcgtccgccaaattaaaaacacggacctcaac
cccgtctatctcttcatctcgccgccatccctcgcaactctgcgcgcccgcctgcgtggc
cgaggaaccgagacagaagccagcgtagagaaacgcctcaacatggctctcaaggaggtc
gactatgcaaaacagcctggtgtccacgatattgtcatcgtcaacgacgacctggaccgt
gcctatgagctgttcaaacaggtggccctgggagagcgcatacccggcgatcccctaccg
cctctagacgactag

DBGET integrated database retrieval system