KEGG   Coprinopsis cinerea: CC1G_13740Help
Entry
CC1G_13740        CDS       T01275                                 

Definition
3',5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cci  Coprinopsis cinerea
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cci00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 358 aa AA seqDB search
MSDFSQEEKVAIAAVKRASILTSSVFEKLVKNETLVKGDKSPVTVGDFAAQAVISTILHN
AFPNDPIVGEEDASDLRVESGKAMKDRIVALANEALTAPLTQGEDPAWGVGPGKERTADQ
ILEAIDRGNYPGGSTGRMWTIDPIDGTKGFLRGEQYAVCVSLIVDAKVQVGVIGCPNLPV
DPAEPSKGVGCIFTAVRGKGARQIAFSSSSPGADGATISLSIPQTLELKDLSFLESVEAA
HSSHSFNDRVAAILNVQQPPTRMDSQAKYACLARGQGGAYLRMPTGVGYKEKIWDHAPGE
ILVTEAGGIVTDSRGEPLNFGLGRTLGENYGVIAAAKTIHGEILAAVQKAQNEAKAKV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacttttcgcaggaggaaaaagtggccatcgcagccgtgaagcgggcgtccatc
ttgacatcatcggtgttcgaaaagctggtcaagaacgagaccctcgtcaagggagataaa
tccccagtaacagtcggcgatttcgcagcccaagcagtgatcagcacgatcctgcacaat
gcatttcccaatgaccccatcgtcggtgaagaagacgcttcagatctccgtgtggagagc
ggaaaggccatgaaggaccgaattgtggctctcgcaaatgaagccttgaccgcacccctc
actcaaggcgaagaccctgcatggggcgtcggacctggaaaagagcgtaccgcagaccag
attctcgaggcgatcgacagaggcaactatcccggcggaagcactggacgaatgtggacc
atcgaccccattgatggcaccaaaggtttcctccgcggcgaacagtacgcagtctgcgtc
tccctaatcgtcgatgccaaagtccaagttggcgtcatcggctgccccaacctccccgtc
gatcctgccgaaccctcaaaaggcgtaggctgcatcttcacagccgtccgaggcaagggt
gctcgacagatcgcgttctcgtcatcatcacccggtgccgatggagcaaccatctccctc
agcattcctcaaaccctcgaactcaaagacttgagcttcttggagagtgtagaagcagct
cactcgtcccattccttcaatgatagggttgccgccattttgaacgtccagcagcctcct
acccggatggacagccaagccaaatacgcgtgccttgctcgaggccaaggcggagcctac
ctccgtatgccaactggtgttgggtacaaggaaaagatctgggatcatgcacctggtgaa
atcttggtcacggaagctggcggtatcgtcacagactctcgcggggagcctctcaacttt
ggcctgggacgaaccctcggagagaactatggagttatcgcagctgccaaaacgatccac
ggggagattttggctgcggttcaaaaggcccaaaacgaggccaaggcaaaggtgtaa

DBGET integrated database retrieval system