KEGG   Coprinopsis cinerea: CC1G_13740Help
Entry
CC1G_13740        CDS       T01275                                 

Definition
3',5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cci  Coprinopsis cinerea
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CC1G_13740
Enzymes [BR:cci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CC1G_13740
Transfer RNA biogenesis [BR:cci03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CC1G_13740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 358 aa AA seqDB search
MSDFSQEEKVAIAAVKRASILTSSVFEKLVKNETLVKGDKSPVTVGDFAAQAVISTILHN
AFPNDPIVGEEDASDLRVESGKAMKDRIVALANEALTAPLTQGEDPAWGVGPGKERTADQ
ILEAIDRGNYPGGSTGRMWTIDPIDGTKGFLRGEQYAVCVSLIVDAKVQVGVIGCPNLPV
DPAEPSKGVGCIFTAVRGKGARQIAFSSSSPGADGATISLSIPQTLELKDLSFLESVEAA
HSSHSFNDRVAAILNVQQPPTRMDSQAKYACLARGQGGAYLRMPTGVGYKEKIWDHAPGE
ILVTEAGGIVTDSRGEPLNFGLGRTLGENYGVIAAAKTIHGEILAAVQKAQNEAKAKV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacttttcgcaggaggaaaaagtggccatcgcagccgtgaagcgggcgtccatc
ttgacatcatcggtgttcgaaaagctggtcaagaacgagaccctcgtcaagggagataaa
tccccagtaacagtcggcgatttcgcagcccaagcagtgatcagcacgatcctgcacaat
gcatttcccaatgaccccatcgtcggtgaagaagacgcttcagatctccgtgtggagagc
ggaaaggccatgaaggaccgaattgtggctctcgcaaatgaagccttgaccgcacccctc
actcaaggcgaagaccctgcatggggcgtcggacctggaaaagagcgtaccgcagaccag
attctcgaggcgatcgacagaggcaactatcccggcggaagcactggacgaatgtggacc
atcgaccccattgatggcaccaaaggtttcctccgcggcgaacagtacgcagtctgcgtc
tccctaatcgtcgatgccaaagtccaagttggcgtcatcggctgccccaacctccccgtc
gatcctgccgaaccctcaaaaggcgtaggctgcatcttcacagccgtccgaggcaagggt
gctcgacagatcgcgttctcgtcatcatcacccggtgccgatggagcaaccatctccctc
agcattcctcaaaccctcgaactcaaagacttgagcttcttggagagtgtagaagcagct
cactcgtcccattccttcaatgatagggttgccgccattttgaacgtccagcagcctcct
acccggatggacagccaagccaaatacgcgtgccttgctcgaggccaaggcggagcctac
ctccgtatgccaactggtgttgggtacaaggaaaagatctgggatcatgcacctggtgaa
atcttggtcacggaagctggcggtatcgtcacagactctcgcggggagcctctcaacttt
ggcctgggacgaaccctcggagagaactatggagttatcgcagctgccaaaacgatccac
ggggagattttggctgcggttcaaaaggcccaaaacgaggccaaggcaaaggtgtaa

DBGET integrated database retrieval system