KEGG   Coprinopsis cinerea: CC1G_13871Help
Entry
CC1G_13871        CDS       T01275                                 

Definition
(RefSeq) tryptophan synthetase
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
cci  Coprinopsis cinerea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CC1G_13871
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CC1G_13871
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CC1G_13871
Enzymes [BR:cci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CC1G_13871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 704 aa AA seqDB search
MEAIKKVFEQKKAQDATAFVAFVTAGYPKKEDTVPVLLALQAGGADIIELGIPFSDPIAD
GPVIQEANTVALKNDIDYPTVLGQIREARQQGLTAPVLLMGYYNPMLAYGEDKAIQDAAE
AGANGFIMVDLPPEEAIAFRQKCAASNLSYVPLIAPSTTLKRIQFLASIADSFIYVVSKM
GTTGSSANVAVNEELPTILSRIREYTHVPLAVGFGVATRDQFNYVADAGADGVVIGSRIV
NAIKAAGDGEVPQFVENYCREVSGKGEPSRVRSPGAAQRTPSQLTPNAETAKGVENILPA
RFGQFGGQYVPESLVDALAELEEAHKSAIEDPAFWEEVRSLYTYSNRPSNLYLAENLTKE
AGGANIWLKREDLNHTGSHKINNALGQILLAKRIGKTRIIAETGAGQHGVATATVCAKFG
LECVIYMGAEDVRRQALNVFRIEMLGGKAWVIPVHSGSCTLKDAVNEAMRDWVTNLSTTH
YLVGSAIGPHPFPTIVRDFQKVIGEEIKAQLKEVRGKLPDVVVACVGGGSNAIGTFYDFI
PDKSVRLVGVEAGGEGIDGHKHSATLSMGQPGVLHGVRTYILQDKAGQIIETHSISAGLD
YPGVGPEHAWLKDSGRADYVVCTDEDALRGFRMLTQKEGIIPALESSHAIWEGVKIAKSL
PKDKDIVICLSGRGDKDVEQISELLPKWADKLDWHVSSNAIPSK
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggaagctatcaaaaaggttttcgaacagaaaaaggctcaggatgcgactgccttcgtt
gctttcgtgaccgcgggataccccaagaaagaagacactgtaccggtcctgctagcattg
caggctggtggtgcagatatcattgaattgggcattccattctccgatcctattgcagat
ggtcctgttatccaggaagcaaacactgtcgcactcaaaaatgacattgattaccctaca
gttcttggacaaataagagaggcccgacaacaagggcttaccgcgcctgtgttgctcatg
ggctactacaaccctatgttggcctacggagaagacaaggccatccaagatgcagcagag
gccggtgccaatggcttcatcatggtcgatcttccacctgaagaagccatcgctttccgg
caaaaatgtgccgcctccaacctgtcttatgtgccacttattgcaccctccaccaccctc
aaacgaattcaattcctggcttccattgcggactcattcatctatgtcgtctcgaagatg
ggtaccacgggttcctccgccaatgtcgctgtcaacgaagaactgcctaccattctttct
cgcatccgggaatatacccatgtcccactggctgtcggatttggggtcgctacccgggac
cagttcaactacgtcgccgatgctggagcagatggtgttgttattggcagtcgaattgta
aatgccatcaaggccgccggcgatggagaagttccgcaattcgtggagaactattgccga
gaggtatctggaaagggcgagccatcccgcgttcgttctccaggagccgctcaacgcacg
ccatcccagctgactcccaatgccgaaactgcaaagggggtggagaacatccttcccgct
cgttttggccaatttggtggtcaatacgtaccagagtctttggtcgatgcacttgctgag
ctggaggaggctcacaagtcagccatagaagaccccgccttctgggaagaagtccgaagt
ttgtatacctacagcaaccgaccctccaacctctacctcgctgagaatctcaccaaggaa
gctggtggtgccaacatttggttgaagcgagaagacctgaaccataccggatcgcacaag
attaacaacgctctcggccagatcctcctcgccaagcggattggcaagacgcgaatcatc
gcagagaccggtgctggtcaacacggtgtcgccactgcaacagtctgtgccaaatttggc
ctcgaatgtgtcatctacatgggtgccgaggatgtgaggagacaggcactcaacgtcttc
cggattgaaatgttgggtggaaaggcatgggttattcccgttcactccggctcctgtacc
ttgaaagacgcggtcaacgaggccatgcgcgactgggtcaccaatctctcaaccacccac
tatcttgttggatccgccatcggcccccatcccttcccgaccatcgtcagagacttccag
aaagtcatcggagaggagatcaaggcacagctgaaggaagttcgaggaaaactccctgac
gtcgtcgttgcctgtgtcggtggtggcagcaacgccattggaaccttctacgatttcatt
cccgataaatctgttcgccttgtcggtgtcgaagcggggggtgaaggtatcgatggacac
aagcacagcgctaccttgtctatgggccagcccggtgtccttcatggagtcaggacgtac
atcttgcaggataaggcgggtcagattatcgagacccattcgatcagtgccggtctcgac
tatccaggtgtaggacccgagcacgcttggttgaaagactctggtcgtgcagactacgtc
gtttgcaccgacgaagatgctttgcgtggtttccgaatgctcactcagaaagagggcatc
atcccagcgctcgagtcgtcgcacgccatctgggaaggtgtcaagatcgctaaatcactg
ccaaaggataaggacatcgtcatttgcttgtctggccgtggagacaaggatgttgaacaa
atctccgagctgctgcccaagtgggccgataagctcgactggcacgtctcttcgaatgcc
atcccttcgaagtaa

DBGET integrated database retrieval system