KEGG   Coprinopsis cinerea: CC1G_13871Help
Entry
CC1G_13871        CDS       T01275                                 

Definition
tryptophan synthetase
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
cci  Coprinopsis cinerea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CC1G_13871
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CC1G_13871
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CC1G_13871
Enzymes [BR:cci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CC1G_13871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 704 aa AA seqDB search
MEAIKKVFEQKKAQDATAFVAFVTAGYPKKEDTVPVLLALQAGGADIIELGIPFSDPIAD
GPVIQEANTVALKNDIDYPTVLGQIREARQQGLTAPVLLMGYYNPMLAYGEDKAIQDAAE
AGANGFIMVDLPPEEAIAFRQKCAASNLSYVPLIAPSTTLKRIQFLASIADSFIYVVSKM
GTTGSSANVAVNEELPTILSRIREYTHVPLAVGFGVATRDQFNYVADAGADGVVIGSRIV
NAIKAAGDGEVPQFVENYCREVSGKGEPSRVRSPGAAQRTPSQLTPNAETAKGVENILPA
RFGQFGGQYVPESLVDALAELEEAHKSAIEDPAFWEEVRSLYTYSNRPSNLYLAENLTKE
AGGANIWLKREDLNHTGSHKINNALGQILLAKRIGKTRIIAETGAGQHGVATATVCAKFG
LECVIYMGAEDVRRQALNVFRIEMLGGKAWVIPVHSGSCTLKDAVNEAMRDWVTNLSTTH
YLVGSAIGPHPFPTIVRDFQKVIGEEIKAQLKEVRGKLPDVVVACVGGGSNAIGTFYDFI
PDKSVRLVGVEAGGEGIDGHKHSATLSMGQPGVLHGVRTYILQDKAGQIIETHSISAGLD
YPGVGPEHAWLKDSGRADYVVCTDEDALRGFRMLTQKEGIIPALESSHAIWEGVKIAKSL
PKDKDIVICLSGRGDKDVEQISELLPKWADKLDWHVSSNAIPSK
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggaagctatcaaaaaggttttcgaacagaaaaaggctcaggatgcgactgccttcgtt
gctttcgtgaccgcgggataccccaagaaagaagacactgtaccggtcctgctagcattg
caggctggtggtgcagatatcattgaattgggcattccattctccgatcctattgcagat
ggtcctgttatccaggaagcaaacactgtcgcactcaaaaatgacattgattaccctaca
gttcttggacaaataagagaggcccgacaacaagggcttaccgcgcctgtgttgctcatg
ggctactacaaccctatgttggcctacggagaagacaaggccatccaagatgcagcagag
gccggtgccaatggcttcatcatggtcgatcttccacctgaagaagccatcgctttccgg
caaaaatgtgccgcctccaacctgtcttatgtgccacttattgcaccctccaccaccctc
aaacgaattcaattcctggcttccattgcggactcattcatctatgtcgtctcgaagatg
ggtaccacgggttcctccgccaatgtcgctgtcaacgaagaactgcctaccattctttct
cgcatccgggaatatacccatgtcccactggctgtcggatttggggtcgctacccgggac
cagttcaactacgtcgccgatgctggagcagatggtgttgttattggcagtcgaattgta
aatgccatcaaggccgccggcgatggagaagttccgcaattcgtggagaactattgccga
gaggtatctggaaagggcgagccatcccgcgttcgttctccaggagccgctcaacgcacg
ccatcccagctgactcccaatgccgaaactgcaaagggggtggagaacatccttcccgct
cgttttggccaatttggtggtcaatacgtaccagagtctttggtcgatgcacttgctgag
ctggaggaggctcacaagtcagccatagaagaccccgccttctgggaagaagtccgaagt
ttgtatacctacagcaaccgaccctccaacctctacctcgctgagaatctcaccaaggaa
gctggtggtgccaacatttggttgaagcgagaagacctgaaccataccggatcgcacaag
attaacaacgctctcggccagatcctcctcgccaagcggattggcaagacgcgaatcatc
gcagagaccggtgctggtcaacacggtgtcgccactgcaacagtctgtgccaaatttggc
ctcgaatgtgtcatctacatgggtgccgaggatgtgaggagacaggcactcaacgtcttc
cggattgaaatgttgggtggaaaggcatgggttattcccgttcactccggctcctgtacc
ttgaaagacgcggtcaacgaggccatgcgcgactgggtcaccaatctctcaaccacccac
tatcttgttggatccgccatcggcccccatcccttcccgaccatcgtcagagacttccag
aaagtcatcggagaggagatcaaggcacagctgaaggaagttcgaggaaaactccctgac
gtcgtcgttgcctgtgtcggtggtggcagcaacgccattggaaccttctacgatttcatt
cccgataaatctgttcgccttgtcggtgtcgaagcggggggtgaaggtatcgatggacac
aagcacagcgctaccttgtctatgggccagcccggtgtccttcatggagtcaggacgtac
atcttgcaggataaggcgggtcagattatcgagacccattcgatcagtgccggtctcgac
tatccaggtgtaggacccgagcacgcttggttgaaagactctggtcgtgcagactacgtc
gtttgcaccgacgaagatgctttgcgtggtttccgaatgctcactcagaaagagggcatc
atcccagcgctcgagtcgtcgcacgccatctgggaaggtgtcaagatcgctaaatcactg
ccaaaggataaggacatcgtcatttgcttgtctggccgtggagacaaggatgttgaacaa
atctccgagctgctgcccaagtgggccgataagctcgactggcacgtctcttcgaatgcc
atcccttcgaagtaa

DBGET integrated database retrieval system