KEGG   Coprinopsis cinerea: CC1G_13880Help
Entry
CC1G_13880        CDS       T01275                                 

Definition
ubiquitin specific protease 48 isoform b
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
cci  Coprinopsis cinerea
Brite
Enzymes [BR:cci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CC1G_13880
Peptidases [BR:cci01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CC1G_13880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 191 aa AA seqDB search
MTISARFSKLFMSHLDAEFKKQSDPVVRNLIASQFQGSQVYGTVCHTCNYTSERSSDFLE
IEVNIKANSRLEDRIKIALEPEVLTQDNQYLCPQCNSLQDATRYTELRQLPPVLHFSLLR
FVYDLSTMERKKSKHVITFPAVLDMGQFLGKQGDGVPNDNAQNIYELRGILLHKGSSAYH
GHYEAQVYDTQ
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttcggccagattttcgaagcttttcatgtcccatcttgacgcagaattcaag
aaacagtcggatcccgttgtcagaaacctcatagcatcgcagttccaagggagccaggtg
tatgggaccgtatgtcatacctgcaattacacctcggaacgcagttccgatttcctagag
attgaagtcaacattaaggccaactccaggctcgaggatcgcattaaaattgcattggag
cctgaagttctaacacaggacaatcagtacctctgcccgcaatgtaactctctgcaggat
gcaacgcggtacacggagctacgccaactccctcccgttctccatttttctcttctccgg
ttcgtgtatgacctctcaacgatggaacggaagaaatcgaaacacgtcatcaccttccct
gccgttcttgacatgggccagtttctcggaaaacagggagatggcgtccccaatgacaac
gctcaaaacatctatgaactgcgtggaatcctgctgcacaaaggaagcagtgcctaccat
ggccattacgaggcgcaggtctacgacacgcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system