KEGG   Coprinopsis cinerea: CC1G_13902Help
Entry
CC1G_13902        CDS       T01275                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
cci  Coprinopsis cinerea
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cci00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 484 aa AA seqDB search
MSLSPTSIRVRLSSSHHDLTYQWTDTELIVAHDRKKDKASKQVKSHRIPHENVLRVSYDP
KGSSLSVSYIKPKKKKKPASLVVLTGAVQDGEEKAAAENWAETAMKCLYDNRGIKPARRL
LVFVNPHGGSGRAVKIFNKTVKPILQAAGCSLKVIQTERHKHAYEVVKAMDLEYDAIVTV
SGDGLVHEVLNGLAQHAQPLKALTTPVAPIPAGSGNGLSLNLLGLDNGFDATQAALNAVK
GRPMRIDLFSVVQNGKRSISFMSQSLGLMADLDLDTEHLRWMGDTRFMYGFLRGVLAFEA
CPVQLSIKVAEKDKDKMAEIAHARNQEVCVCNLEDDKTAAAHASLPALRYLPDDNDGWYT
IDEPILFVYAGQGPYVGRDYMAFPVSLPDDGLIDIAAMPLSSRKDALANISTAPTGECFW
FPKLHYFKAEAYRIKTLGKKGNLSIDGERFPFEEYQVEVHPGLGTLLSPHGRFVAEFKPR
SASK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgagcccgaccagcattcgtgtccgcctttcttcgtcgcaccatgacttgaca
tatcaatggaccgacaccgagctcatcgttgcgcacgaccgaaagaaagacaaagcctcc
aagcaggttaaatcccaccgtataccccatgaaaatgtactgcgcgtctcttatgatccc
aaaggctcgagtctatcggtttcatacatcaaacccaagaagaagaagaaacccgcgtcg
ctagtggttctaactggcgcggttcaggatggtgaagagaaggcggcagcagagaactgg
gcagagactgccatgaagtgcctatacgacaaccgtggtatcaagccagcccgacgtctg
ctcgttttcgtcaatcctcacggaggcagcggccgagcagtcaagattttcaacaagact
gtaaaacctatcctccaagctgctggttgctcgctgaaggtcattcaaaccgaacgacat
aaacatgcgtacgaggttgtcaaggctatggacctggaatacgatgccattgtcactgtg
tctggcgatgggctggttcatgaagtgcttaacggactcgcccaacacgctcagccgctc
aaggcattgaccacgcctgtcgctcccattccggctggctctgggaacggtctttcactc
aaccttcttgggctagacaatgggtttgatgctacccaagcggcactgaacgcagtcaaa
gggcgtcccatgcgcatagaccttttctctgtcgttcagaatggcaaacggagcatatct
ttcatgtctcaatctctgggtttaatggcagatcttgacctcgatacggaacaccttcgc
tggatgggagatacccgtttcatgtatggtttcttacgtggtgtccttgcatttgaagct
tgcccggttcaactgtcgataaaggtggccgagaaggacaaggacaagatggctgaaatc
gcacatgcccgaaaccaggaagtctgtgtatgcaatttggaagatgataaaaccgctgca
gcgcacgcatcgctcccggcgttaagataccttccagacgataacgatggttggtatacc
atagatgaacccatcttattcgtttatgctgggcagggcccttatgtgggaagggactac
atggcattccccgtttcgctaccggacgacggcttgattgatattgctgcaatgccactc
tcctccagaaaggatgccctcgccaacatctccactgcaccaacaggagagtgtttctgg
ttccctaaacttcattacttcaaggctgaagcgtacagaataaagactctcggaaagaaa
ggcaacttgtcgattgatggggagcgtttccccttcgaagagtaccaggtggaggtccac
ccaggccttggaacccttctcagccctcacggtcggtttgtcgcagagttcaaacctcgg
tctgcctccaagtag

DBGET integrated database retrieval system