KEGG   Coprinopsis cinerea: CC1G_13904Help
Entry
CC1G_13904        CDS       T01275                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
cci  Coprinopsis cinerea
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:cci00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CC1G_13904
   03420 Nucleotide excision repair
    CC1G_13904
   03430 Mismatch repair
    CC1G_13904
   03440 Homologous recombination
    CC1G_13904
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 265 aa AA seqDB search
MSQGFYGGSGGGGYLPGSPFSATASPGGGQKSELSASLRPMTIAQLNKATQLHPEAEWRL
DDIEVGQVTIVGQILSIQQQATNSVYAIVDGTGTIEARQWLNTDTDGSIQQGLKENIYVR
VAGNLKAFNSRRYINTTHIRPITDPHELYFHILESMTVTLSFERGVPAAPGSAKGKDVVM
ADASVYNVGSTATSDQFSHLPVLQRQIVRFLQENSTSDEGVHVSAIARAVGSGNDAQKIS
DALDKLMDAGHVYTTLDESHFLLTA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaggattctatggtggcagtggtggcggaggttacctcccaggatcacctttc
agcgcgacagccagtccagggggaggccaaaaatcagagctctcagcatctctacgtcca
atgaccatcgcccaactcaacaaagcgactcaactgcatcctgaagctgaatggcgcctc
gacgatattgaagttggccaagtcaccatagtcgggcaaatattgtccattcagcaacag
gcaaccaactctgtgtacgcaatcgttgatggcacaggaacaatcgaggctcgccagtgg
ttgaacaccgacaccgacggcagcatacaacaagggctcaaggaaaacatctacgttcgt
gttgccggcaacctcaaggccttcaattccagacgatatatcaatacaactcacatccgt
ccaatcactgacccccatgaactctacttccacattctcgaatccatgaccgtaactctg
agctttgagcggggcgttcctgcagctccaggatctgccaaaggaaaagatgtggtcatg
gctgacgcttctgtatacaatgttgggtcgactgcgacatccgaccaattctcgcacctg
ccagttttgcagcgtcagattgtccgcttcctccaggagaactctacgagcgacgaagga
gtgcacgtctcggccattgccagagctgtcgggtctggtaacgatgcccaaaagatcagc
gatgccctggacaagctcatggatgctggtcacgtatacacaacgcttgatgaatcgcat
ttcctactcactgcctag

DBGET integrated database retrieval system